[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09690.1
DDBJ      :             protein of unknown function DUF81
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  107/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   127->204 2bc1A PDBj 4e-04 16.7 %
:RPS:PFM   33->241 PF01925 * TauE 4e-12 32.7 %
:HMM:PFM   7->255 PF01925 * TauE 1.2e-43 36.9 233/239  
:BLT:SWISS 32->241 YDHB_BACSU 2e-09 24.0 %
:TM
:REPEAT 2|30->81|171->223
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09690.1 GT:GENE ABF09690.1 GT:PRODUCT protein of unknown function DUF81 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3064686..3065459) GB:FROM 3064686 GB:TO 3065459 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF81 GB:PROTEIN_ID ABF09690.1 GB:DB_XREF GI:93355601 InterPro:IPR002781 LENGTH 257 SQ:AASEQ MSLAYTVSGLLVGLLVGLTGVGGGSLMTPLLTLLFGFSPATAVGTDLAFASITKGFGTLAHRAHGHVQWQVVRRLCVGSLPAAVAAILVLKSAGELNAQWLHAIRVTIGVSVLLTVLSLLFRKQMLAWLARNPRFQLEGRKQVVATVLVGAVIGVLVTVSSIGAGAVGATLILLLYPHMKPAEVAGTDIAYAVPLTAVAGLGHVWLGTVDWNLLLALLVGSIPGIWLGAQLSRALPERIVRAALATTLTLVAIKLVS GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 32->241|YDHB_BACSU|2e-09|24.0|200/245| TM:NTM 6 TM:REGION 10->32| TM:REGION 75->97| TM:REGION 100->121| TM:REGION 149->171| TM:REGION 195->217| TM:REGION 236->257| NREPEAT 1 REPEAT 2|30->81|171->223| SEG 6->26|tvsgllvgllvgltgvgggsl| SEG 110->120|vsvlltvlsll| SEG 242->250|aalattltl| RP:PDB:NREP 1 RP:PDB:REP 127->204|2bc1A|4e-04|16.7|78/473| RP:PFM:NREP 1 RP:PFM:REP 33->241|PF01925|4e-12|32.7|196/237|TauE| HM:PFM:NREP 1 HM:PFM:REP 7->255|PF01925|1.2e-43|36.9|233/239|TauE| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| OP:NHOMO 112 OP:NHOMOORG 109 OP:PATTERN ------------------------------------------------------1----1-------- ----------------------------------------1------1----------------------------------1--1---------------1-----------------------------------------------1--1--------------1-1-----------------------1-------11-----------11----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-----1----------------------------1--111-111-------------------------11111-----------------------------------1-1-----111111111111111111111121111121111111---111--111-1111--------11-111-------------------------------------------------------------1--2---------------------------1---------------------------------------------------------------------------------------------------------1-1-1---------------1111111----1----1111-1111-111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 30.4 SQ:SECSTR ##############################################################################################################################EEEEcccTTccccccEEEEEEEEETTTccEEEEEEEEccccGHHHHHHHHTTccHHHHHTcccccTTcHHHHHHHTcc##################################################### DISOP:02AL 1-1,134-136| PSIPRED ccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //