[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09699.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->98 PF05444 * DUF753 0.00047 25.0 44/152  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09699.1 GT:GENE ABF09699.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3073223..3073552 GB:FROM 3073223 GB:TO 3073552 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09699.1 GB:DB_XREF GI:93355610 LENGTH 109 SQ:AASEQ MKEVEGVARIGALFVAALASMASTVVVAQSNSNDRSAYVQRGLSAFQPQSVPMQDCQRSAADFASHGQCGQGDLACVARLEHELKNTVEKNCVRAIEELRPKPQLYPLP GT:EXON 1|1-109:0| HM:PFM:NREP 1 HM:PFM:REP 53->98|PF05444|0.00047|25.0|44/152|DUF753| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,109-110| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //