[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09704.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09704.1 GT:GENE ABF09704.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3080324..3080989 GB:FROM 3080324 GB:TO 3080989 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09704.1 GB:DB_XREF GI:93355615 LENGTH 221 SQ:AASEQ MPAKPEWRDSLEARKRPIRVLALLEALADASIFEAPLRVVHELAYLSNVLAPVFELAPFSASLLKRQGGPYYPELQDTIDLLVGRGMVFASGIRYEPVPEEKRYRLHANYRINRALAGSALAAYHEVYADTGEPFFIGELCAAYSMLADQELGQAFRFDARYADKDVDNNEVIDFGQWVSAASTNFSRNAAMSFRPGESLQPAERIFMYIEHVQRKVAHGG GT:EXON 1|1-221:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,217-222| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHccHHHHccccccccccHHEEEEEcccEEHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHEEHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccc //