[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09717.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:230 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->56 1mvfD  b.129.1.1 * 4e-04 22.6 %
:HMM:PFM   95->199 PF01724 * DUF29 5.6e-06 21.6 102/139  
:HMM:PFM   25->55 PF04014 * SpoVT_AbrB 1.4e-05 48.4 31/47  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09717.1 GT:GENE ABF09717.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3093805..3094497 GB:FROM 3093805 GB:TO 3094497 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09717.1 GB:DB_XREF GI:93355628 LENGTH 230 SQ:AASEQ MGNTNTWKARLQDAGNGSVDRILELPDEVMAVMGWGIGDELELVPSGKGEIRLRKVCPAEESDYSRHLGVTYALLLQLREVTAERDANKLTEIASSIDWSAIASEFETVAGRYRSAVFRHGRRIIRNLRRPYMLYHDCTELAIQVDMLSSAIEDSPSLRATAEKALEEAYHAVLSRETLRGRPPQGAPAASPWPTLEALMEAAEDKRRRGHALQAAAHTGYLNGQRVFLE GT:EXON 1|1-230:0| SEG 93->104|iassidwsaias| SEG 119->130|rhgrriirnlrr| HM:PFM:NREP 2 HM:PFM:REP 95->199|PF01724|5.6e-06|21.6|102/139|DUF29| HM:PFM:REP 25->55|PF04014|1.4e-05|48.4|31/47|SpoVT_AbrB| RP:SCP:NREP 1 RP:SCP:REP 25->56|1mvfD|4e-04|22.6|31/44|b.129.1.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,180-188,203-209| PSIPRED ccccccHHHHHHccccccHHHHHHcHHHHHHHHcccccccEEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcc //