[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09726.1
DDBJ      :             protein of unknown function DUF886
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  181/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->125 1yllD PDBj 8e-21 47.3 %
:RPS:SCOP  12->155 1yllA1  b.82.1.17 * 4e-16 33.3 %
:HMM:SCOP  3->189 1yllA1 b.82.1.17 * 2.4e-56 44.0 %
:RPS:PFM   11->156 PF05962 * HutD 1e-43 57.2 %
:HMM:PFM   8->164 PF05962 * HutD 2.5e-59 51.3 156/184  
:BLT:SWISS 3->150 VES_ESCF3 4e-28 43.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09726.1 GT:GENE ABF09726.1 GT:PRODUCT protein of unknown function DUF886 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3101719..3102294) GB:FROM 3101719 GB:TO 3102294 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF886 GB:PROTEIN_ID ABF09726.1 GB:DB_XREF GI:93355637 InterPro:IPR010282 LENGTH 191 SQ:AASEQ MKFGLDRIVPTPWKNGGGTTREIAVWPPGAGMDTFDWRISVADIAMDGPFSAFPGIDRQIVLIDGAGVHLQAHDDSFCHKLRHLGEPFAFSGDSAVHATLVDGPTRDFNVMTRRGVCRAEVRLMRQAFTADPTDATVLILVLRGAWDCGDGQHMTAGDGIVMVPGAPAVTMIHDEMSALCLRVALHKEPVR GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 3->150|VES_ESCF3|4e-28|43.4|143/191| BL:PDB:NREP 1 BL:PDB:REP 10->125|1yllD|8e-21|47.3|112/193| RP:PFM:NREP 1 RP:PFM:REP 11->156|PF05962|1e-43|57.2|145/183|HutD| HM:PFM:NREP 1 HM:PFM:REP 8->164|PF05962|2.5e-59|51.3|156/184|HutD| RP:SCP:NREP 1 RP:SCP:REP 12->155|1yllA1|4e-16|33.3|141/190|b.82.1.17| HM:SCP:REP 3->189|1yllA1|2.4e-56|44.0|184/0|b.82.1.17|1/1|RmlC-like cupins| OP:NHOMO 187 OP:NHOMOORG 184 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1------------111--1---------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1----------11111111111---------11--111111111111-------1-----11-----------1------------------------------------1---11--1111111111111121111111111111--1111-1--1-1111-------1------------1------------------------------------------------------------11----1-----11111--111--1------------------11111111111111111-1111111121111111111111---------------------11111111--111111111111---1-------------1---------------111111------1111111111111-111------------------------11-1-11------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------1--21------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 60.7 SQ:SECSTR ########cccEcTTccEEEEEEEE#ccccGGGcccEEEEEEEEcccEEEcccTTcEEEEEEEEcccEEEEETTTEEcccccccTccEEEETTccEEEEEccccEEEEEEEEcTTTEEEEEEEEE################################################################## DISOP:02AL 1-1,5-5,189-192| PSIPRED ccccccccccccEEccccEEEEEEEcccccccccEEEEEEEEEEcccccccccccccEEEEEEEcccEEEEEccccccccccccccEEEEccccEEEEEEccccEEEEEEEEcccccEEEEEEEcccccccccccEEEEEEEcccccccccccccccccEEEEccccEEEEccccccEEEEEEEEcccccc //