[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09731.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  482/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   151->224 3dhwA PDBj 2e-05 31.1 %
:RPS:PDB   187->222 3dhwA PDBj 9e-11 41.7 %
:RPS:SCOP  85->240 2onkC1  f.58.1.1 * 2e-10 10.3 %
:RPS:PFM   187->247 PF00528 * BPD_transp_1 5e-05 41.0 %
:HMM:PFM   115->284 PF00528 * BPD_transp_1 7.9e-27 24.7 170/185  
:BLT:SWISS 74->287 Y3648_BRUA2 7e-32 34.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09731.1 GT:GENE ABF09731.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3107292..3108167) GB:FROM 3107292 GB:TO 3108167 GB:DIRECTION - GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABF09731.1 GB:DB_XREF GI:93355642 InterPro:IPR000515 LENGTH 291 SQ:AASEQ MSQASTPTTAAAARVPAPIEAQGAPARRARHPWMSPLVPVSPRARWLLGMSFFVAFFAVWAVATLGGFVSRTFLADPLTMAHEGWRLFTQYGFIGDIGMTVWRVVGGFVLAALLAVPLGIFMGAYKAAEAFFEPFVSFCRYLPASAFIPLLILWAGIGETQKLLVIFIGSFFQIVLMVAVTVGGARKDLVEAAYTLGATPRGIVRRVLIPGAAPDIAETLRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGCIGLVSDLVFKQANQRLFPWSSIK GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 74->287|Y3648_BRUA2|7e-32|34.6|214/250| TM:NTM 5 TM:REGION 47->69| TM:REGION 98->120| TM:REGION 153->175| TM:REGION 217->239| TM:REGION 252->274| SEG 4->21|astpttaaaarvpapiea| SEG 52->63|ffvaffavwava| SEG 257->270|gqiifgiivigcig| BL:PDB:NREP 1 BL:PDB:REP 151->224|3dhwA|2e-05|31.1|74/203| RP:PDB:NREP 1 RP:PDB:REP 187->222|3dhwA|9e-11|41.7|36/203| RP:PFM:NREP 1 RP:PFM:REP 187->247|PF00528|5e-05|41.0|61/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 115->284|PF00528|7.9e-27|24.7|170/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 85->240|2onkC1|2e-10|10.3|156/252|f.58.1.1| OP:NHOMO 1543 OP:NHOMOORG 508 OP:PATTERN ----1------------------1--------11-111111112211-111111------1------- -11-1--1112---433----2---B------24447574-21321---11-3-2111--11---233243-111---1--1---------1-211---------------------1--1111-1---1-----11111----322-3111212232-1--131-3312-1-----------121-----1-12222224332322345-11-12211-2-2--------17-11111111111111----1----11---------21--1-11--------------------------------------11---111-112251111221-1-2266-----121-11---75-42-1--4111--11--1222------45GGM-24A228355545454548-DCBB9799371-E99862665564FC1--4283624424323333331---33-------------------------------1-11-15FCA328888223332556633332354F9697-3664255225654DB141162411----------1231341211-112--2115--2-31-111119151221-----------------1-----3121121-2-2---------------------1-211------5455-443333333333-3333333323333333333575771111111111111111111522332331-244444424444--------------231------1-111-1--15554512---9565455653346342543---------2-11------121--1-2--------------3-------------------------------------------1----------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------2--2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 25.4 SQ:SECSTR ######################################################################################################################################################HTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHH################################################################### DISOP:02AL 1-11| PSIPRED ccccccccHHHHHccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccc //