[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09753.1
DDBJ      :             two component transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  631/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->189 1rnlA PDBj 2e-20 34.5 %
:RPS:PDB   7->217 3c3wA PDBj 8e-27 29.5 %
:RPS:SCOP  6->141 1a04A2  c.23.1.1 * 3e-17 20.0 %
:RPS:SCOP  158->217 1fseA  a.4.6.2 * 1e-12 35.0 %
:HMM:SCOP  3->125 1s8nA_ c.23.1.1 * 2.6e-21 29.4 %
:HMM:SCOP  136->218 1p4wA_ a.4.6.2 * 1.1e-15 39.8 %
:RPS:PFM   8->121 PF00072 * Response_reg 1e-06 29.7 %
:RPS:PFM   156->209 PF00196 * GerE 2e-12 55.6 %
:HMM:PFM   158->209 PF00196 * GerE 1.9e-17 42.3 52/58  
:HMM:PFM   8->120 PF00072 * Response_reg 2.4e-16 27.3 110/112  
:BLT:SWISS 1->189 NARL_SHIFL 4e-18 31.2 %
:BLT:SWISS 166->203 DCTR_RHOCA 1e-05 50.0 %
:PROS 172->199|PS00622|HTH_LUXR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09753.1 GT:GENE ABF09753.1 GT:PRODUCT two component transcriptional regulator, LuxR family GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3131733..3132392 GB:FROM 3131733 GB:TO 3132392 GB:DIRECTION + GB:PRODUCT two component transcriptional regulator, LuxR family GB:PROTEIN_ID ABF09753.1 GB:DB_XREF GI:93355664 InterPro:IPR000792 InterPro:IPR001789 InterPro:IPR013249 LENGTH 219 SQ:AASEQ MLNAAPTLLVVDDHPMALSGTTAFLAEVMPDVAVHSAGSAKEALHSLNQGLRPDIVLLDIWLNDGTGFDAMQSFKTVIPGARFIFMSAEATPEIVGRARALSACGFVGKHLDANAFTAAVRKVLAGDTSFPSDEALSGRSQSFGPAHGIPVTPAELGLTPRQGSVLALVLEGLPNKVIARKLGLTENTVKEHVSAILQRLGVRTRMQVMSRMERFRLRQ GT:EXON 1|1-219:0| BL:SWS:NREP 2 BL:SWS:REP 1->189|NARL_SHIFL|4e-18|31.2|186/216| BL:SWS:REP 166->203|DCTR_RHOCA|1e-05|50.0|38/197| PROS 172->199|PS00622|HTH_LUXR_1|PDOC00542| BL:PDB:NREP 1 BL:PDB:REP 7->189|1rnlA|2e-20|34.5|168/200| RP:PDB:NREP 1 RP:PDB:REP 7->217|3c3wA|8e-27|29.5|207/211| RP:PFM:NREP 2 RP:PFM:REP 8->121|PF00072|1e-06|29.7|111/111|Response_reg| RP:PFM:REP 156->209|PF00196|2e-12|55.6|54/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 158->209|PF00196|1.9e-17|42.3|52/58|GerE| HM:PFM:REP 8->120|PF00072|2.4e-16|27.3|110/112|Response_reg| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 6->141|1a04A2|3e-17|20.0|135/138|c.23.1.1| RP:SCP:REP 158->217|1fseA|1e-12|35.0|60/67|a.4.6.2| HM:SCP:REP 3->125|1s8nA_|2.6e-21|29.4|119/190|c.23.1.1|1/1|CheY-like| HM:SCP:REP 136->218|1p4wA_|1.1e-15|39.8|83/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 2152 OP:NHOMOORG 635 OP:PATTERN -------------------------------------------------------------------- 8A83J3242222-1422----3--25-----16444AFED566K7E433854543222--36A4LBHNSL81222211-32-8-----11----11-------2-62612--------------------------6668A666B5812611211---1--1213296591-1-----1----37412--2345444444453644554756647465132541222222296222222222222222222221---22-----11--22211---1111111-112111111111111111111111111112-1112111115-3-1111111-1-1-------2-1--91-1-73112123-21111---4-12112-----25F471-23344522222222222-76776976374-522332436357121-14-23534334---------111-432-------------------------------24--33211211211333322239333413324768D-17753743346346132-53-2311111111--2325-12--132-12--1-2-32-32233343222-------------------------1--32-6216362133233-4434423334244--1-321------32231514443433344-444443344443444444222233222434444444434444454433343--444444344444--1113112111112622111112-1111-11211111111-11197896A59877745676----------2332233331433487667665562222--1-221111--------2-------------------------------------2E- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------2--2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 100.0 SQ:SECSTR cccccEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEEccHHHHHHHHHHHTcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHETTHccTTTTccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTTHH DISOP:02AL 1-3,139-157,219-220| PSIPRED ccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccHHcccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccc //