[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09757.1
DDBJ      :             riboflavin kinase / FMN adenylyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  853/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.43.5c.26.1
:342 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->304 1s4mA PDBj 1e-26 34.9 %
:RPS:PDB   16->183 2a7xA PDBj 4e-19 19.9 %
:RPS:PDB   194->304 3bnwA PDBj 1e-32 21.7 %
:RPS:SCOP  33->199 1mrzA2  c.26.1.3 * 5e-19 28.4 %
:RPS:SCOP  214->304 1mrzA1  b.43.5.1 * 1e-28 30.6 %
:HMM:SCOP  28->189 1kqnA_ c.26.1.3 * 2.2e-38 38.9 %
:HMM:SCOP  187->336 1n08A_ b.43.5.1 * 1.9e-43 43.9 %
:RPS:PFM   30->180 PF06574 * FAD_syn 5e-37 47.7 %
:RPS:PFM   198->304 PF01687 * Flavokinase 5e-19 47.1 %
:HMM:PFM   26->180 PF06574 * FAD_syn 1.8e-57 47.7 155/158  
:HMM:PFM   197->321 PF01687 * Flavokinase 1.8e-39 43.1 123/125  
:BLT:SWISS 16->326 RIBF_SHIFL 7e-71 46.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09757.1 GT:GENE ABF09757.1 GT:PRODUCT riboflavin kinase / FMN adenylyltransferase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3137460..3138488 GB:FROM 3137460 GB:TO 3138488 GB:DIRECTION + GB:PRODUCT riboflavin kinase / FMN adenylyltransferase GB:PROTEIN_ID ABF09757.1 GB:DB_XREF GI:93355668 InterPro:IPR002606 InterPro:IPR004821 LENGTH 342 SQ:AASEQ MVCSYPPQKRSSAVLVKVFRGLPNAESRAPCALTIGNFDGVHRGHQSLLARARAAADARGLPLCVMTFEPHPREFFAPEHAPTRIALLRDKLDALRRNGVDRVVVEHFNAHFAAQSPQAFVENVLWHGLHARWVLVGDDFRFGAKRAGDFSYLQEAGRQFGFDVEQMGSVSEGGIRISSSAVRQALAGGDLEHARRLLGHGYAISGHVIHGRKLGRDLGFPTLNLRISHKRPAVNGIFVVQVHGIADHPVPGVASIGVRPTVEDAGRVLLEVHLFDFNENLYGKLIRVEFMKKLRDEKRYDSLEALTAAIAKDAADARAFFGQTAPDAGRRDFATSATDRIS GT:EXON 1|1-342:0| BL:SWS:NREP 1 BL:SWS:REP 16->326|RIBF_SHIFL|7e-71|46.3|309/313| SEG 50->59|araraaadar| SEG 84->97|riallrdkldalrr| SEG 305->319|altaaiakdaadara| BL:PDB:NREP 1 BL:PDB:REP 33->304|1s4mA|1e-26|34.9|249/277| RP:PDB:NREP 2 RP:PDB:REP 16->183|2a7xA|4e-19|19.9|151/277| RP:PDB:REP 194->304|3bnwA|1e-32|21.7|106/160| RP:PFM:NREP 2 RP:PFM:REP 30->180|PF06574|5e-37|47.7|151/157|FAD_syn| RP:PFM:REP 198->304|PF01687|5e-19|47.1|104/125|Flavokinase| HM:PFM:NREP 2 HM:PFM:REP 26->180|PF06574|1.8e-57|47.7|155/158|FAD_syn| HM:PFM:REP 197->321|PF01687|1.8e-39|43.1|123/125|Flavokinase| GO:PFM:NREP 4 GO:PFM GO:0003919|"GO:FMN adenylyltransferase activity"|PF06574|IPR015864| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF06574|IPR015864| GO:PFM GO:0008531|"GO:riboflavin kinase activity"|PF01687|IPR015865| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF01687|IPR015865| RP:SCP:NREP 2 RP:SCP:REP 33->199|1mrzA2|5e-19|28.4|155/157|c.26.1.3| RP:SCP:REP 214->304|1mrzA1|1e-28|30.6|85/109|b.43.5.1| HM:SCP:REP 28->189|1kqnA_|2.2e-38|38.9|157/0|c.26.1.3|1/1|Nucleotidylyl transferase| HM:SCP:REP 187->336|1n08A_|1.9e-43|43.9|148/154|b.43.5.1|1/1|Riboflavin kinase-like| OP:NHOMO 875 OP:NHOMOORG 856 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111211111111111111111-------111111111111111111---1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111121221111111111212111212112222221111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111211-1111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111-11111111111111111111111111111111111-111111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--------2-1-1------1--11----1-1--111111111-111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 88.3 SQ:SECSTR ##cTTTTTcccHHHHcEEEccHHHHHHTTccEEEEEEcccccHHHHHHHHHHHHHTTccTccEEEEEEcccGGGccTTccGGGccccHHHHHHHHHTTTccEEEcccHHHHccTTcccccccccGGGTTTHHHHHcccEEEEEGGGHHHHHHHHHHHHHTTcccEEEEEccTTcccccGGGGGccHHTHHHHHcccTTcccEEEEEEEEccccccHcccccccEEcccHHHHHHHGGGTTEEEEEEEETTEEEEEEEEEEEEEEEEccEEEEEccccccccTTcEEEEEEEEEEEEccccccHH###################################### DISOP:02AL 1-7,328-330,341-343| PSIPRED cccccccccccccEEEEEEcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEcccHHHHcccHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHcccEEEEEccEEEccEEEcHHHHHHHHHcccHHHHHHHccccEEEEEEEEEcccccccccccEEEEEccccccccccEEEEEEEEEccEEEEEEEEEccccccccccEEEEEEEEEcccccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEccccc //