[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09766.1
DDBJ      :             ATP-dependent Clp protease adaptor protein ClpS
Swiss-Prot:CLPS_RALME   RecName: Full=ATP-dependent Clp protease adapter protein clpS;

Homologs  Archaea  0/68 : Bacteria  420/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.45.1
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->108 1r6qD PDBj 5e-30 58.0 %
:RPS:PDB   29->107 3dnjB PDBj 4e-28 58.2 %
:RPS:SCOP  18->108 1lzwA  d.45.1.2 * 4e-29 54.9 %
:HMM:SCOP  22->108 1mbxC_ d.45.1.2 * 1.1e-32 49.4 %
:RPS:PFM   24->93 PF02617 * ClpS 2e-18 62.9 %
:HMM:PFM   25->105 PF02617 * ClpS 1.5e-36 50.6 81/82  
:BLT:SWISS 1->108 CLPS_RALME 3e-59 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09766.1 GT:GENE ABF09766.1 GT:PRODUCT ATP-dependent Clp protease adaptor protein ClpS GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3149398..3149724) GB:FROM 3149398 GB:TO 3149724 GB:DIRECTION - GB:PRODUCT ATP-dependent Clp protease adaptor protein ClpS GB:PROTEIN_ID ABF09766.1 GB:DB_XREF GI:93355677 InterPro:IPR003769 LENGTH 108 SQ:AASEQ MATRLANTPQRETGTVIERKEQQLKPPAMYKVVLLNDDYTPMEFVVMILQQYFSRDRETATQIMLTVHREGKGVCGIYTRDIAATKVELVSTHARQAGHPLQCVMEEA GT:EXON 1|1-108:0| SW:ID CLPS_RALME SW:DE RecName: Full=ATP-dependent Clp protease adapter protein clpS; SW:GN Name=clpS; OrderedLocusNames=Rmet_2893; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->108|CLPS_RALME|3e-59|100.0|108/108| BL:PDB:NREP 1 BL:PDB:REP 21->108|1r6qD|5e-30|58.0|88/93| RP:PDB:NREP 1 RP:PDB:REP 29->107|3dnjB|4e-28|58.2|79/81| RP:PFM:NREP 1 RP:PFM:REP 24->93|PF02617|2e-18|62.9|70/76|ClpS| HM:PFM:NREP 1 HM:PFM:REP 25->105|PF02617|1.5e-36|50.6|81/82|ClpS| GO:PFM:NREP 1 GO:PFM GO:0030163|"GO:protein catabolic process"|PF02617|IPR003769| RP:SCP:NREP 1 RP:SCP:REP 18->108|1lzwA|4e-29|54.9|91/91|d.45.1.2| HM:SCP:REP 22->108|1mbxC_|1.1e-32|49.4|87/87|d.45.1.2|1/1|ClpS-like| OP:NHOMO 446 OP:NHOMOORG 420 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------1--------------------------------------------111-----1--------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------11------------11------1-------------------------1-111111111112222212222211111111111-11111111221122222222222211111-1111111111111111121111111------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------1-111111111--111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----111111111---------------11111111111111111111111111111---------111111111111111111111111211111-1-111111--------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 84.3 SQ:SECSTR #################cHHccccccccEEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcEEEEEEEEHHHHHHHHHHHHHHHHHTTccccEEEEEc DISOP:02AL 1-23,107-109| PSIPRED cccccccccccccccEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEcc //