[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09770.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->64 PF10721 * DUF2514 0.00066 27.9 61/162  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09770.1 GT:GENE ABF09770.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3153144..3153344 GB:FROM 3153144 GB:TO 3153344 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABF09770.1 GB:DB_XREF GI:93355681 LENGTH 66 SQ:AASEQ MKKLIAALVVGLFATGAFAQASAPAAADAAAPAAKEAKPAKSTSKKHHSSKKHSSKKTEASAPAAQ GT:EXON 1|1-66:0| TM:NTM 1 TM:REGION 4->26| SEG 14->58|atgafaqasapaaadaaapaakeakpakstskkhhsskkhsskkt| HM:PFM:NREP 1 HM:PFM:REP 4->64|PF10721|0.00066|27.9|61/162|DUF2514| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,27-67| PSIPRED cHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccc //