[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09784.1
DDBJ      :             phosphoribosylformylglycinamidine cyclo-ligase
Swiss-Prot:PUR5_RALME   RecName: Full=Phosphoribosylformylglycinamidine cyclo-ligase;         EC=6.3.3.1;AltName: Full=AIRS;AltName: Full=Phosphoribosyl-aminoimidazole synthetase;AltName: Full=AIR synthase;

Homologs  Archaea  60/68 : Bacteria  819/915 : Eukaryota  181/199 : Viruses  1/175   --->[See Alignment]
d.139.1d.79.4
:350 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->350 1cliA PDBj e-104 55.5 %
:RPS:PDB   11->343 1cliA PDBj 1e-83 58.9 %
:RPS:SCOP  11->175 1cliA1  d.79.4.1 * 2e-55 69.7 %
:RPS:SCOP  176->348 1cliA2  d.139.1.1 * 2e-41 47.4 %
:HMM:SCOP  10->175 1cliA1 d.79.4.1 * 8.8e-54 47.0 %
:HMM:SCOP  176->349 1cliA2 d.139.1.1 * 4.4e-59 50.0 %
:RPS:PFM   96->147 PF00586 * AIRS 3e-06 51.9 %
:RPS:PFM   182->339 PF02769 * AIRS_C 2e-07 40.3 %
:HMM:PFM   182->344 PF02769 * AIRS_C 1e-35 33.3 144/151  
:HMM:PFM   49->147 PF00586 * AIRS 3.3e-22 33.3 93/96  
:BLT:SWISS 1->350 PUR5_RALME 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09784.1 GT:GENE ABF09784.1 GT:PRODUCT phosphoribosylformylglycinamidine cyclo-ligase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3165378..3166430) GB:FROM 3165378 GB:TO 3166430 GB:DIRECTION - GB:PRODUCT phosphoribosylformylglycinamidine cyclo-ligase GB:PROTEIN_ID ABF09784.1 GB:DB_XREF GI:93355695 InterPro:IPR000728 InterPro:IPR004733 InterPro:IPR010918 LENGTH 350 SQ:AASEQ MSASPTAGQAGLSYRDAGVDIEAGDALVDRIKPFAKRTMREGVMAGIGGFGALFELSKKYQEPVLVSGTDGVGTKLKLAFQLNRHDTVGQDLVAMSVNDILVQGAEPLFFLDYFACGKLDVETAATVIKGIAHGCELAGCALIGGETAEMPSMYPDGEYDLAGFAVGAVEKKKIIDGSTITPGDVVLGLASSGAHSNGYSLVRKIIDVARPNLDADFHGQRLQDAIMAPTRIYVKPLLSLIETLPVKGMAHITGGGLTENVPRVLADNVTAVIQRDAWTLPPLFQWLQAEGRVADAEMHRVFNCGIGMVVIVAKEDAERAIRHLQAAGEAVWQIGEIRERAEGQAQTVVV GT:EXON 1|1-350:0| SW:ID PUR5_RALME SW:DE RecName: Full=Phosphoribosylformylglycinamidine cyclo-ligase; EC=6.3.3.1;AltName: Full=AIRS;AltName: Full=Phosphoribosyl-aminoimidazole synthetase;AltName: Full=AIR synthase; SW:GN Name=purM; OrderedLocusNames=Rmet_2911; SW:KW ATP-binding; Complete proteome; Cytoplasm; Ligase; Nucleotide-binding;Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->350|PUR5_RALME|0.0|100.0|350/350| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 12->350|1cliA|e-104|55.5|337/341| RP:PDB:NREP 1 RP:PDB:REP 11->343|1cliA|1e-83|58.9|333/341| RP:PFM:NREP 2 RP:PFM:REP 96->147|PF00586|3e-06|51.9|52/97|AIRS| RP:PFM:REP 182->339|PF02769|2e-07|40.3|139/148|AIRS_C| HM:PFM:NREP 2 HM:PFM:REP 182->344|PF02769|1e-35|33.3|144/151|AIRS_C| HM:PFM:REP 49->147|PF00586|3.3e-22|33.3|93/96|AIRS| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00586|IPR000728| RP:SCP:NREP 2 RP:SCP:REP 11->175|1cliA1|2e-55|69.7|165/166|d.79.4.1| RP:SCP:REP 176->348|1cliA2|2e-41|47.4|173/175|d.139.1.1| HM:SCP:REP 10->175|1cliA1|8.8e-54|47.0|166/0|d.79.4.1|1/1|PurM N-terminal domain-like| HM:SCP:REP 176->349|1cliA2|4.4e-59|50.0|174/175|d.139.1.1|1/1|PurM C-terminal domain-like| OP:NHOMO 1128 OP:NHOMOORG 1061 OP:PATTERN --11--1111111111-111111111111111111111111111111111111111111-1111--11 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111-111---1111111-11----------------1111111111111111111111111111111111111111111111111111111111111113111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111121111111---------------1111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------1---------------------------1-11111111111 ----111-----11111111111111111111111111111111111111111111111111111111111111111-1111111111-12111111111111111-12-21212141111111111113A1-11311111111-1111-111215222253111-111163112111182-11121321231121111 -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 340 STR:RPRED 97.1 SQ:SECSTR ##########cTTTccccccTTHHHHHHHHTHHHHHTTccTTEEccccccccEEcccTTcccEEEEEEEEEccTHHHHHHHTTccccHHHHHHHHHHHHHGGGTcEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEcTTTccTTcEEEEEEEEEEEEGGGccccTTccTTcEEEEEEccccTTccHHHHHHHHHHTccTTTcccccccHHHHHHccccccHHHHHHHHHHccccEEEEccTTHHHHHGGGcccTTEEEEEcGGGccccHHHHHHHHHHTccHHHHHHHccTTEEEEEEEcGGGHHHHHHHHHTTTccEEEEEEEEEcccccccEEEc DISOP:02AL 1-15| PSIPRED cccccccccccccHHHHcccHHHHHHHHHHHHHHHHHccccccEEcccccEEEEEcccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEccccEEcccccccccEEEEEEEEEEEcHHHcccHHHcccccEEEEEcccccHHHHHHHHHHHHHHccccccccccccHHHHHHcccHHccHHHHHHHHHcccccEEEEcccccHHHHHHHHHHcccEEEEEcHHccccHHHHHHHHHccccHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHccccEEEEEEEEEcccccccEEEc //