[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09792.1
DDBJ      :             ABC transporter-related protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  877/915 : Eukaryota  168/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:229 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   10->57 2d2fA PDBj 5e-04 39.6 %
:BLT:PDB   30->209 3dhwC PDBj 1e-17 33.0 %
:RPS:PDB   8->211 3b5jA PDBj 2e-25 22.3 %
:RPS:SCOP  9->209 1b0uA  c.37.1.12 * 2e-23 27.4 %
:HMM:SCOP  12->224 1ii8.1 c.37.1.12 * 8.3e-54 38.9 %
:RPS:PFM   49->160 PF00005 * ABC_tran 4e-12 45.5 %
:HMM:PFM   49->175 PF00005 * ABC_tran 1.1e-19 37.4 115/118  
:HMM:PFM   143->209 PF02463 * SMC_N 0.00042 33.3 66/220  
:HMM:PFM   20->53 PF03308 * ArgK 6e-05 44.1 34/267  
:BLT:SWISS 8->207 Y043_BIFLO 8e-23 36.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09792.1 GT:GENE ABF09792.1 GT:PRODUCT ABC transporter-related protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3172568..3173257 GB:FROM 3172568 GB:TO 3173257 GB:DIRECTION + GB:PRODUCT ABC transporter-related protein GB:PROTEIN_ID ABF09792.1 GB:DB_XREF GI:93355703 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 LENGTH 229 SQ:AASEQ MRTRTPAPLLTVRGLSRRVGARKLFDIAELDFPRATAIALTGVNGAGKSTLLRIVAGLEPAPGATASWTDADGTAHTVPLSPLPMSLRRRIAYMHQHPYLFRTSVRENIAYGLRHHGLPRDEIDRRVGAALGWAGVVHVQDTAPDKLSGGEIQRVALARAKVLEPDLLLLDEPTSSLDGHAREQVIALIGELAAEGRTVVMVCHDRELINLPGVVRWKLGEGRLDTRHK GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 8->207|Y043_BIFLO|8e-23|36.7|196/780| SEG 163->173|lepdlllldep| BL:PDB:NREP 2 BL:PDB:REP 10->57|2d2fA|5e-04|39.6|48/246| BL:PDB:REP 30->209|3dhwC|1e-17|33.0|176/343| RP:PDB:NREP 1 RP:PDB:REP 8->211|3b5jA|2e-25|22.3|197/243| RP:PFM:NREP 1 RP:PFM:REP 49->160|PF00005|4e-12|45.5|101/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 49->175|PF00005|1.1e-19|37.4|115/118|ABC_tran| HM:PFM:REP 143->209|PF02463|0.00042|33.3|66/220|SMC_N| HM:PFM:REP 20->53|PF03308|6e-05|44.1|34/267|ArgK| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 9->209|1b0uA|2e-23|27.4|201/258|c.37.1.12| HM:SCP:REP 12->224|1ii8.1|8.3e-54|38.9|211/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 18154 OP:NHOMOORG 1113 OP:PATTERN 5442974545454381K387567AKABIIBFB73944297953DCBJI9ELIJ5BC8B98A432C111 9DG9nI9JGGIBBCDBE88-8I44Dj999999NNPNJhbb8OFSMNKKLGFARLPBEE44MNJISORkUcLEEEESIIGBVLF31344EE7B-7676--248765A46C8-------22322224EEBCE88C99BCGGLN122JHHBKG88JGL88C28785CHEOKHO627341-16443-DADDDB93BFHRRSQSRVUOUYQTRYUFHHOJTTXCEILIFJJNNNNLddBEEFCFEDFFEEEFEB9998IFCFJKDEGFDNMDDLMBB9CKJGGGHGIKIHIKKMMKKLKJJLKKJGGGGFGGGGGGGGPKJFFGLLLIAIIJNNMNOLOMIKFDKGGADD9IBFFAZDDH8WXJKEMJEEIDEEE9AAJ5DHFFB9A79BLC*r*GGNdWQVOWYUXYVZYVZ*-JNfMGWQYd*E3************sd68AUf*fddifZYFFFFFFFFELN89JIV221-1---11--12112121111131111375973UmiUZbjkhjhWVTVQhhrvZXYXIakd*VXZO38SQRXNSQPaQlZlzGNSBA8BNHCCBBAAAHEDJNHEHeDHFOLGIQIJS6FJHJFHOCMDGGJVNLG6768688897732444444449558CCWPV8O9C6D9NEEGHFAEIFGGGFFIDHGF3-499FA------bSjdEWUSTTRTUQUTR-URRTRRVTQUUVTOQRPPTotqflIJERQPPRRRRRRQPRPPQdMNJPQNRD-UWWUWWVVVWXX12A8554558889E6ZMbFFFIGE67A78B9AGFGGFF9F99EPGSRQTRfdgUUbRTGeej5554555459GMKQPSQRRRURPPEFB8988898877722977744551---1---G7844421-112-25311131141-1118C7578AACA5LD ----632-1-1-354526-47938276553423374153453334342685575668144333--1-2----11-----12---1-22-1-1213-1224212313-4FGC57AG6831522766818-Mx9-86434317159824223643M3B37J7Gt2H7B2753FDF853234X-4143GCBN2FF32A2133 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,225-230| PSIPRED ccccccccEEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccccccHHHHHHHHcccEEEEEcccHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHccccHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEEccEEEcccc //