[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09811.1
DDBJ      :             pyrroline-5-carboxylate reductase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  775/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->240 1yqgA PDBj 4e-31 41.4 %
:RPS:PDB   38->243 2b0jA PDBj 3e-17 11.8 %
:RPS:SCOP  9->160 1yqgA2  c.2.1.6 * 6e-31 37.4 %
:RPS:SCOP  163->250 1yqgA1  a.100.1.10 * 1e-25 42.0 %
:HMM:SCOP  5->160 1xc2A2 c.2.1.6 * 4.3e-32 35.1 %
:HMM:SCOP  161->271 1xc2A1 a.100.1.10 * 7.6e-34 46.8 %
:RPS:PFM   8->99 PF03807 * F420_oxidored 3e-07 41.3 %
:HMM:PFM   7->99 PF03807 * F420_oxidored 3.7e-20 34.4 93/96  
:BLT:SWISS 9->249 P5CR_PSEAE 3e-41 40.7 %
:PROS 221->244|PS00521|P5CR
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09811.1 GT:GENE ABF09811.1 GT:PRODUCT pyrroline-5-carboxylate reductase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3192912..3193733 GB:FROM 3192912 GB:TO 3193733 GB:DIRECTION + GB:PRODUCT pyrroline-5-carboxylate reductase GB:PROTEIN_ID ABF09811.1 GB:DB_XREF GI:93355722 InterPro:IPR000304 InterPro:IPR004455 LENGTH 273 SQ:AASEQ MLDSLTFGFLGGGNMASALIGGLVARGVPANAIRVVDPFEDARQRLATTLGVQTLAAPDAAFGASNVIVLAVKPQQFKDAVGALAPQLKNSLIISVAAGIRLQDMQRWLGTNRLVRAMPNTPALAGMGMTGLAAAPGLSDEDRAIAKAVAEAVGQCVWVEGDDQIDAVTAISGSGPAYVFYFVEAMERAAIEMGLSAEQGRKLAVETFRGAAALAAESSEPVSTLRERVTSKGGTTYAALTSMDASGIQDAFVRAMLAAAARGREMGAEFGKD GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 9->249|P5CR_PSEAE|3e-41|40.7|241/273| PROS 221->244|PS00521|P5CR|PDOC00451| SEG 122->138|palagmgmtglaaapgl| SEG 251->271|afvramlaaaargremgaefg| BL:PDB:NREP 1 BL:PDB:REP 41->240|1yqgA|4e-31|41.4|191/254| RP:PDB:NREP 1 RP:PDB:REP 38->243|2b0jA|3e-17|11.8|204/344| RP:PFM:NREP 1 RP:PFM:REP 8->99|PF03807|3e-07|41.3|92/96|F420_oxidored| HM:PFM:NREP 1 HM:PFM:REP 7->99|PF03807|3.7e-20|34.4|93/96|F420_oxidored| RP:SCP:NREP 2 RP:SCP:REP 9->160|1yqgA2|6e-31|37.4|147/152|c.2.1.6| RP:SCP:REP 163->250|1yqgA1|1e-25|42.0|88/111|a.100.1.10| HM:SCP:REP 5->160|1xc2A2|4.3e-32|35.1|151/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 161->271|1xc2A1|7.6e-34|46.8|111/0|a.100.1.10|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1289 OP:NHOMOORG 991 OP:PATTERN 11----1-1111111111---------111-1--1--------------1111--1-1-111111--- 11-1111111111111111-1111111111111111111111111-111111111111--111111111111---211--11111111112111-------1-2211111--------------11111111111111111111111111111111111111-11112121111111111111-111111112243434434234444422442244311111111111112211111111111111111111211----1---1122111111111111111111111111111111111111111111111111111111111111111111111112221111211--111111111111-111111--11111111-----111111111111111111111111-11111211111-5112222222211121211211111111111111111111111---11111----------------------11112122111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-11111111----------1111111111111111111111112111112111111--11111------11111111111111111-11111111111111111111211111111111111111111111111111111111111111111--1111111111111111111111-1111111122222111111111111111121111111111111111111111111111111111111111111111111111111---------1---------------------------11--11111111 11-1122-311-111213111112211111111---111111-111222332421131211111111111111111111111111111-12111111111111212-13144533222111133432A2DV4-6541212343311312-3--33212123312121315A22312112F1112211221112121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 91.2 SQ:SECSTR HHcccEEEEEcccHHHHHHHHHHTTcccEEEEEEEEcTTEEEEcccGGGGTcEEEccHHHHHTTccEEEEccTTcTTHHHHHHHGGGccTTcEEEEcccHHHHHHHHHTTcTTcEEEEccccccTTTcccEEEEEccccHHHHHHHHHHHHHHHccEEEEEHHHHHHHHcTTHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHcccGGGHHHHccGGGGGGTGGGGccHHHHHH######################## DISOP:02AL 1-3,267-274| PSIPRED cccccEEEEEcccHHHHHHHHHHHHccccHHEEEEEcccHHHHHHHHHHcccEEEccHHHHHccccEEEEEccHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHcccccEEEEccccHHHHHccHHHHHccccccHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccc //