[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09824.1
DDBJ      :             periplasmic sensor signal transduction histidine kinase
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  753/915 : Eukaryota  34/199 : Viruses  0/175   --->[See Alignment]
a.26.1a.30.2d.122.1
:462 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   244->461 3d36B PDBj 3e-18 30.3 %
:RPS:PDB   234->461 2c2aA PDBj 8e-30 21.6 %
:RPS:SCOP  204->307 1csgA  a.26.1.2 * 1e-09 11.0 %
:RPS:SCOP  317->446 1gjvA2  d.122.1.4 * 1e-22 30.2 %
:HMM:SCOP  224->310 2c2aA1 a.30.2.1 * 4.8e-06 20.7 %
:HMM:SCOP  307->460 1gkzA2 d.122.1.4 * 1.9e-36 36.4 %
:RPS:PFM   240->299 PF00512 * HisKA 4e-04 28.3 %
:RPS:PFM   358->461 PF02518 * HATPase_c 3e-14 46.5 %
:HMM:PFM   351->460 PF02518 * HATPase_c 3.4e-24 38.7 106/111  
:HMM:PFM   242->304 PF00512 * HisKA 2e-11 23.0 61/68  
:BLT:SWISS 66->167 Y1193_THEEB 2e-04 33.7 %
:BLT:SWISS 224->458 FIXL_AZOC5 6e-25 33.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09824.1 GT:GENE ABF09824.1 GT:PRODUCT periplasmic sensor signal transduction histidine kinase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3208827..3210215) GB:FROM 3208827 GB:TO 3210215 GB:DIRECTION - GB:PRODUCT periplasmic sensor signal transduction histidine kinase GB:PROTEIN_ID ABF09824.1 GB:DB_XREF GI:93355735 InterPro:IPR003594 InterPro:IPR003661 InterPro:IPR004358 InterPro:IPR005467 LENGTH 462 SQ:AASEQ MSSPKPLSVEDSAAQPAKAMSSNKLYAGYQSELADFRLAFSRGGAYTAIVLVLLGVGLDYGQYPQWQVPFAAARIVVSLLIAGVVVALYSQAGRRFAPWLTMTWLLLPQIMIAWMISQTEGVESPYYVGLNLAIFASGIALPFGLWQNLVFGVLSYVLYAAACLLHPGGIEPVGTFIVNSLFLLFAAAASGVYTFFNERARFMLFRLKAEVADKNAELEVINRKLVDIKGQMLQQEKMAAIGTLAAGLLHEVNNPVNFCLMAIEVAMEEPAAKSEPGIQECLVDAKQGMQRIQHIVSDLKTFAYRKPGAEVEGTPFLFEKALDSSQRLTAHELRGVKMTREMPDDTLVLGDEAAIIGVLINLFSNAALAMRKAGTQNPAIHTTVRWEDKRLRVTVRDNGPGIAQEHLARVFEPFFTTREVGQGLGLGLSISYAVIERHGGVLYAESEVGQWAAFSFDLPRAE GT:EXON 1|1-462:0| BL:SWS:NREP 2 BL:SWS:REP 66->167|Y1193_THEEB|2e-04|33.7|95/955| BL:SWS:REP 224->458|FIXL_AZOC5|6e-25|33.5|230/504| TM:NTM 6 TM:REGION 37->58| TM:REGION 68->90| TM:REGION 98->120| TM:REGION 123->145| TM:REGION 149->171| TM:REGION 174->196| SEG 50->58|vlvllgvgl| SEG 181->189|lfllfaaaa| BL:PDB:NREP 1 BL:PDB:REP 244->461|3d36B|3e-18|30.3|208/221| RP:PDB:NREP 1 RP:PDB:REP 234->461|2c2aA|8e-30|21.6|222/240| RP:PFM:NREP 2 RP:PFM:REP 240->299|PF00512|4e-04|28.3|60/69|HisKA| RP:PFM:REP 358->461|PF02518|3e-14|46.5|99/112|HATPase_c| HM:PFM:NREP 2 HM:PFM:REP 351->460|PF02518|3.4e-24|38.7|106/111|HATPase_c| HM:PFM:REP 242->304|PF00512|2e-11|23.0|61/68|HisKA| GO:PFM:NREP 4 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF00512|IPR003661| GO:PFM GO:0007165|"GO:signal transduction"|PF00512|IPR003661| GO:PFM GO:0016020|"GO:membrane"|PF00512|IPR003661| GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 2 RP:SCP:REP 204->307|1csgA|1e-09|11.0|100/120|a.26.1.2| RP:SCP:REP 317->446|1gjvA2|1e-22|30.2|126/165|d.122.1.4| HM:SCP:REP 224->310|2c2aA1|4.8e-06|20.7|87/0|a.30.2.1|1/1|Homodimeric domain of signal transducing histidine kinase| HM:SCP:REP 307->460|1gkzA2|1.9e-36|36.4|154/193|d.122.1.4|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 7151 OP:NHOMOORG 808 OP:PATTERN -----------------------11----312---1-122223-A-3356A16--------------8 Fbr1231111-1--11111-1111251111117343222215551-1-12-1352111--11815-11132----1--217111-325IIDH-S11---42723AGAH5F--------------165-6546BHM2PNMSTD59R1WBJN98478342224226A4Ets*D231212242212GA4332248A8EEEEFCCD7FCGGGC4A9886FGG7B96277322322RM1333333333333332332111--11----111----11-1-1-11----------11111111111-------------1--1-1---12D73B2225344-2-35772111335117--85FFFJC5-36432422-1UEEKCCF22322B7YOOC79LMKOK44443444448-dVZWQOhX7FA2CDDCHGAHNHDCHL58587B88985D86666666633347hBD2222111111--111111111-11-1222-36E6254328GCCEDB9ACDCCBGHEEEE8DDGEFHKD25AB9IGE8BCJGJ96BAK4758F71111111238GNTE**PKJlW6smfaa3*n*pdcrFiXYgZ**HhA-4111111-----------BA32822A84FAC86D7AB87786697876D9BC6EE---6E68------9433262888A89AB78-88978997888A7788889657333437666777777787867466565682-455676653776--1322212232266K5E111----------15111211112-C7IJIIHOUMCKKMNMNOQ---1-----6576AEEDEE7CDGHBACDDED9AB111111V1HHACDC11-111111---------------------------13143323333h1 ----21--------511-1------------------111-11---11------------------------------------------111---111-1--111-1--1-----------------------------------------------1------------------212-----6--6---1-2---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 57.4 SQ:SECSTR #####################################################################################################################################################################################################TTccHHHHTcHHHHHHHHHHHHHHHHHHTTcccGGcHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTGGGccTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccEEEHHHHHHHHHHHHHHHTTcEEEEEEccccccEEEEcHHHHHHHHHHHHHHHHHTcccTTcTTcEEEEEEEEETTEEEEEEEEccccccGGGTTGGGcTTcccccTTcccccTHHHHHHHHHHTTcEEEEEEETTTEEEEEEEEEccG DISOP:02AL 1-5,8-23,228-237,272-272,274-274| PSIPRED ccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccHHHHHHHHHHHHHHHccccEEEEEcccccEEEEcHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEccccccHHHHHHHcccccEEcccccccccHHHHHHHHHHHHccEEEEEEEccccEEEEEEEEccc //