[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09837.1
DDBJ      :             NAD/NADP transhydrogenase alpha subunit-like protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  417/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->84 PF08405 * Calici_PP_N 0.00041 27.9 43/358  
:HMM:PFM   6->57 PF11872 * DUF3392 0.00016 17.3 52/106  
:BLT:SWISS 11->92 PNTAB_RHORU 4e-26 58.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09837.1 GT:GENE ABF09837.1 GT:PRODUCT NAD/NADP transhydrogenase alpha subunit-like protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3222136..3222459 GB:FROM 3222136 GB:TO 3222459 GB:DIRECTION + GB:PRODUCT NAD/NADP transhydrogenase alpha subunit-like protein GB:PROTEIN_ID ABF09837.1 GB:DB_XREF GI:93355748 LENGTH 107 SQ:AASEQ MEMVNHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISAIIIVGAMLAAGLTEGGVGRVMGTVAVALAAVNVFGGFLVTQRMLEMFKKKEPKAKADNKGGA GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 11->92|PNTAB_RHORU|4e-26|58.5|82/139| TM:NTM 3 TM:REGION 5->27| TM:REGION 36->58| TM:REGION 66->88| SEG 93->104|kkkepkakadnk| HM:PFM:NREP 2 HM:PFM:REP 42->84|PF08405|0.00041|27.9|43/358|Calici_PP_N| HM:PFM:REP 6->57|PF11872|0.00016|17.3|52/106|DUF3392| OP:NHOMO 585 OP:NHOMOORG 533 OP:PATTERN -----------------------------1-------------1------------------------ -11-1--------111111-1111131-111111111-1-1-1----------11-------1111111---11111----11------------1------------1-------------------------------------112111---1111--11111--111-----11--------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111111111111111111111111-11111111111-211211521111111111111111111111111111--1-111------------11111111-1111----11111-111-211111121111112111111121128411111211-11111121111----111111111111--2--1-----2---------------1111-------------------------------1111121-1-11111111-1111-1-1111---1--1------111111-1111111111-1111111111111111111111111111111111111111111111111111-111111111111----11111111111111111111111111111111111111111111-11111-1111-11----------11111111111111----------------1-111111----------------------------------------------1-- 1122111-1------11-1-11111111111111-111111111111111111111111111----------------------------1-11-----1-------12-214221111---1--1---262-12111111-121111-1111111121-121111--11-11----11----1---1-1--21----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-3,93-108| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccc //