[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09842.1
DDBJ      :             conserved hypothetical protein 701
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  301/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:RPS:PFM   2->122 PF03653 * UPF0093 3e-24 58.3 %
:HMM:PFM   2->140 PF03653 * UPF0093 1.7e-47 49.3 138/147  
:BLT:SWISS 2->140 Y1484_HELPY 3e-16 43.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09842.1 GT:GENE ABF09842.1 GT:PRODUCT conserved hypothetical protein 701 GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3227239..3227661) GB:FROM 3227239 GB:TO 3227661 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein 701 GB:PROTEIN_ID ABF09842.1 GB:DB_XREF GI:93355753 InterPro:IPR005265 LENGTH 140 SQ:AASEQ MLWVKAFHILFVTSWFAGLFYLPRIFVNLAMETDAASVKRLLLMARKLFRFMTMLAVPAVVFGLWLFLGYGIGRGAGQGWMHAKLALVLVLIGYHHGCGVLLRKFERGANTRSHTFYRWFNELPVLVLLAVVILVVVKPF GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 2->140|Y1484_HELPY|3e-16|43.5|138/148| TM:NTM 4 TM:REGION 7->29| TM:REGION 48->70| TM:REGION 77->99| TM:REGION 118->140| SEG 123->137|lpvlvllavvilvvv| RP:PFM:NREP 1 RP:PFM:REP 2->122|PF03653|3e-24|58.3|120/143|UPF0093| HM:PFM:NREP 1 HM:PFM:REP 2->140|PF03653|1.7e-47|49.3|138/147|UPF0093| OP:NHOMO 301 OP:NHOMOORG 301 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------111-----------111-11--1-1------------------------------------1111111--11111111-1-1111--1111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11------11-111111111111111111111-11111111111111111111111111--111-1111-111111111111111111--------111111111111111111111-11--111111111111111111111111111111111111111111111111111111111111111111111111-----------------------------------1111111-11111111111-11-----1111111-----------------------1111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111---------1--------------1111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccc //