[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09855.1
DDBJ      :             Glyoxalase/bleomycin resistance protein/dioxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  126/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->135 1kmzA PDBj 3e-05 36.8 %
:RPS:PDB   14->135 2a4xA PDBj 1e-14 19.8 %
:RPS:SCOP  10->131 1xy7A  d.32.1.9 * 6e-18 27.0 %
:HMM:SCOP  5->133 1u7iA_ d.32.1.7 * 9.5e-26 32.2 %
:RPS:PFM   22->125 PF00903 * Glyoxalase 3e-04 35.1 %
:HMM:PFM   15->129 PF00903 * Glyoxalase 2.5e-16 24.6 114/128  
:BLT:SWISS 8->134 Y911_MYCBO 7e-20 42.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09855.1 GT:GENE ABF09855.1 GT:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION 3241906..3242340 GB:FROM 3241906 GB:TO 3242340 GB:DIRECTION + GB:PRODUCT Glyoxalase/bleomycin resistance protein/dioxygenase GB:PROTEIN_ID ABF09855.1 GB:DB_XREF GI:93355766 InterPro:IPR004360 LENGTH 144 SQ:AASEQ MSRPPNTPWLTPYLTVASGRAALDFYARAFGFAAGHVVDENGVPMHAEMHYEGQLVVMFAPEGAWGSTARTPRSLGVEAPQTFYVYCGDVDAMYQRALAAGAASVTPPADQFWGDRYCMVEDPDGYRWGFATPLPKTPDSKPTP GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 8->134|Y911_MYCBO|7e-20|42.4|125/170| BL:PDB:NREP 1 BL:PDB:REP 74->135|1kmzA|3e-05|36.8|57/125| RP:PDB:NREP 1 RP:PDB:REP 14->135|2a4xA|1e-14|19.8|121/131| RP:PFM:NREP 1 RP:PFM:REP 22->125|PF00903|3e-04|35.1|94/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 15->129|PF00903|2.5e-16|24.6|114/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 10->131|1xy7A|6e-18|27.0|111/120|d.32.1.9| HM:SCP:REP 5->133|1u7iA_|9.5e-26|32.2|121/134|d.32.1.7|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 181 OP:NHOMOORG 127 OP:PATTERN -------------------------------------------------------------------- 111--------1--11111-12--1211111112223111-1---1------1-------------1-------------------------------------------------------------------------------1-------------------111----------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------2112------3---1----11----------------------11-1---11111111-1--1--1---------------------2-------------------------------------11--3222231333122423333122322221--222--------1---2-----1------------1----------------1-1-1-2--1121-1--------------------------------------1------------------------------------------------------------------------------------------------------------------------11111----1-------------------------------1111111--11111----------------------------1---------------------------------------------------------------------1- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 95.8 SQ:SECSTR ######GcccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEcTTccEEEEEEHHHHHcHHcTTccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEEETTTEEEEEEEcTTccEEEEEEEcTcccccccEE DISOP:02AL 1-2,4-4,134-145| PSIPRED ccccccccEEEEEEEEccHHHHHHHHHHHcccEEEEEccccccEEEEEEEEccEEEEEEcccccccccccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEcHHHcccccEEEEEEcccccEEEEEEEccccccccccc //