[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09860.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09860.1 GT:GENE ABF09860.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3245217..3245570) GB:FROM 3245217 GB:TO 3245570 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABF09860.1 GB:DB_XREF GI:93355771 LENGTH 117 SQ:AASEQ MGRTLREHPTARLSLRVAQAPHGRDPIGTGHTRPTSPDAGASATSKWIARIIGFDGASYRLADWGGKHDKRPSRTAFCRKMVIDRNFDDATLLAETSLRLPLQSAYVAPSSQISKDA GT:EXON 1|1-117:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,36-39,112-118| PSIPRED cccHHHHcccEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccEEEcccccccccccHHHHHHHHHHHcccccccEEEEccccccccHHHcccccHHccccc //