[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Ralstonia metallidurans CH34 (rmet0)
Gene : ABF09868.1
DDBJ      :             Phosphonate ABC transporter PhnC, ATP-binding
Swiss-Prot:PHNC2_RALME  RecName: Full=Phosphonates import ATP-binding protein phnC 2;         EC=3.6.3.28;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:279 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   25->232 3dhwC PDBj 3e-31 37.7 %
:RPS:PDB   9->240 3b5jA PDBj 6e-41 28.3 %
:RPS:SCOP  8->252 1b0uA  c.37.1.12 * 1e-38 33.5 %
:HMM:SCOP  12->235 1ii8.1 c.37.1.12 * 5.7e-58 38.2 %
:RPS:PFM   50->181 PF00005 * ABC_tran 2e-18 46.7 %
:HMM:PFM   50->180 PF00005 * ABC_tran 1.6e-26 38.6 114/118  
:HMM:PFM   35->63 PF03193 * DUF258 8.8e-06 31.0 29/161  
:BLT:SWISS 1->279 PHNC2_RALME e-149 100.0 %
:PROS 153->167|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABF09868.1 GT:GENE ABF09868.1 GT:PRODUCT Phosphonate ABC transporter PhnC, ATP-binding GT:DATABASE GIB00349CH01 GT:ORG rmet0 GB:ACCESSION GIB00349CH01 GB:LOCATION complement(3252603..3253442) GB:FROM 3252603 GB:TO 3253442 GB:DIRECTION - GB:PRODUCT Phosphonate ABC transporter PhnC, ATP-binding GB:PROTEIN_ID ABF09868.1 GB:DB_XREF GI:93355779 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 InterPro:IPR012693 LENGTH 279 SQ:AASEQ MKLEKDRDVLSLKGVSVRYVDSTVALHPTSLDVKQGEFLVLLGASGAGKSTLLRSINGLVLPTKGEVSIPGLAGGVVNAKTLREHRKRCGMVFQQHHLIGRQSVLRNVLMGKLGDRGAFASLWPWSKKDKLEALTVIERVGLLEKALSRADALSGGQQQRVGIARALIQKPRILLADEPVASLDPATAHSVLTLLHEICKKDHLTAIVSLHQVELARSFADRIIGLRQGAVVFEGRAEQLSPDVARNLYAKQSNASNTSASTDSPRTLQSSQTKELLPC GT:EXON 1|1-279:0| SW:ID PHNC2_RALME SW:DE RecName: Full=Phosphonates import ATP-binding protein phnC 2; EC=3.6.3.28; SW:GN Name=phnC2; OrderedLocusNames=Rmet_2995; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Hydrolase; Membrane; Nucleotide-binding; Phosphonate transport;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->279|PHNC2_RALME|e-149|100.0|279/279| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015716|"GO:phosphonate transport"|Phosphonate transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 153->167|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 253->262|snasntsast| BL:PDB:NREP 1 BL:PDB:REP 25->232|3dhwC|3e-31|37.7|199/343| RP:PDB:NREP 1 RP:PDB:REP 9->240|3b5jA|6e-41|28.3|223/243| RP:PFM:NREP 1 RP:PFM:REP 50->181|PF00005|2e-18|46.7|122/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 50->180|PF00005|1.6e-26|38.6|114/118|ABC_tran| HM:PFM:REP 35->63|PF03193|8.8e-06|31.0|29/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 8->252|1b0uA|1e-38|33.5|236/258|c.37.1.12| HM:SCP:REP 12->235|1ii8.1|5.7e-58|38.2|220/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 48417 OP:NHOMOORG 1172 OP:PATTERN SSFAKKGDTSRQQPRHjITNMNOXrMPdlRfTH8DCCBGFHEDTXQUkMR*ve8PYQQVMLHHCX188 SYmL*badppsTbRVRVNM-MhAAW*NNNNNNrmnnt***U*U*y**frqfQ**sQSgCCqywg*p****dYUTTxaYbO*cmBAC9CQPPL7NFIJ--EFUJLJbLZPQ7888888CBBBBBBHRPJSWNLRScOhoo**HGG*WvljqfembgRSQJLJQGcgXh***YJRJMMIHTIMHJkadSOok9Sdu********x***************gnw**lnvvvrtt**VijjijfeggiiigfWaXTY*dYbyzZMbUdurOPzwdSPWhggggnmqvqnvvttmrnojjmrknpbcbaZbacecbab*mmdccploij*w*********g*io***Vkhe*lkpl*fiSM**pibdfiSZgYhhPYbXMZXUULLKJKNcY***ZVs****************-ps*li*r***SA**************GKJ**********RQRRRRRRwbgIOlY*66544444563456AB5576476677595KECFCF***************z********n********BO**v*qwnu******YrmNYKRobHHIHHHHSOQcrhd**RfXzqWhwbalJgZbSRXfWbXZWas*Z*KMMRFONNPMHDDDCCDEBCGUHCIMLqruRuTgKWM*TUXZVMXcVSRURTacVZc6-BKXRN331444****Z*z********z*-*************wx*yww*****mnfoqmnoppppqmnpnnn*uoruuuyX3************33GICFCCDMMQOMM*p*bbaYYaLRROMUNThOPSRPHTGOVtg****y***v****i***EFECDFEDFKipo*orppr*****QRONNNMKNMCBBB57LSOOJKKM99787989*CYEBABC-EDEEIDCNMJBHKAGD88AWenRQk*lkiFbO 2243YXF-YL87SfQFBJGFIJKQERHFF8A8AMKI8FBCCCEA78GIJPMJXLHFHBHFEG8687653774B7B46-666987AF55-DF8BCB8AAADE6GIIB3LlXjTXQlbUHED9JTIoc9t9**l3iQqKFJ9cCJka7NGF9XAA*DZQNjGi*IwKWAlVh*mifJCGCD*CCB9KqYc*IuvBBsdpmN ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,8-9,251-267| PSIPRED ccccccccEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHccEEEEccccHHcccHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHHccEEEEEEccEEEEEccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccc //