[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37246.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->49 PF06832 * BiPBP_C 0.00061 37.0 27/90  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37246.1 GT:GENE ABE37246.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(8475..8738) GB:FROM 8475 GB:TO 8738 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37246.1 GB:DB_XREF GI:91680944 LENGTH 87 SQ:AASEQ MRYVAILAIVAVVPGPSAAQEPKPLKTLRIQQAAPGATELFVVDDDGTVRIDWEKVETLARLKTDRIALPTAQVMLAIRDRTWKPMK GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 23->49|PF06832|0.00061|37.0|27/90|BiPBP_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,86-88| PSIPRED ccEEEEEEEHHHcccccccccccccEEEEEEEcccccEEEEEEEcccEEEEEHHHHHHHHHHccccEEccccEEEEEEEcccccccc //