Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37273.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:BLT:SWISS 96->123 Y4JH_RHISN 5e-05 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37273.1 GT:GENE ABE37273.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 39653..40090 GB:FROM 39653 GB:TO 40090 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37273.1 GB:DB_XREF GI:91680971 LENGTH 145 SQ:AASEQ MLEALSKATFDRDIGRIDPRSVRMYDWAIVQANYPVFDVIFNHAQVAPLRLRLVCDDWDEIPPSIELLNKEGQPLATAPPNVGNVFNGSTHPNTGRPFVCMRGAREYHTHGSHTSDLWDNYRGQSGMDLGGIVVQLWRAWKRSVG GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 96->123|Y4JH_RHISN|5e-05|50.0|28/100| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,7-7,145-146| PSIPRED ccHHHHHHHHHHHHcccccccEEEEEEEEEEccccEEEEEEccccccEEEEEEEEccHHHccHHHHHHHHcccccccccccHHHHccccccccccccEEEEEccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcc //