[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37295.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->91 PF08617 * CGI-121 0.00014 24.2 66/161  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37295.1 GT:GENE ABE37295.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(67486..67848) GB:FROM 67486 GB:TO 67848 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37295.1 GB:DB_XREF GI:91680993 LENGTH 120 SQ:AASEQ MRLAPSWIIRQSQLLASTERAAEQSVAPTFAECGHSPLEGWTPHSARQKMQLPVSSHPHRDIVLSAAAPGHIVDACEKSRPNQPRSRIDVVDICLQTTPSPASAVSPHRSREPRKSLTSN GT:EXON 1|1-120:0| HM:PFM:NREP 1 HM:PFM:REP 3->91|PF08617|0.00014|24.2|66/161|CGI-121| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,79-84,101-121| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccHHHHHHcccccccccccEEEEEcccccHHHHHHHHcccccccHHccHHHHHHHccccccccccccccccHHHHHHcc //