[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37299.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   101->152 PF07254 * DUF1434 0.00056 38.8 49/132  
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37299.1 GT:GENE ABE37299.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 70113..70730 GB:FROM 70113 GB:TO 70730 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37299.1 GB:DB_XREF GI:91680997 InterPro:IPR002453 LENGTH 205 SQ:AASEQ MRDLDKALADIIAIRSQIAAGTAFRGYGPTALAATAGLALITAVLQSLWLDEPDSHPLSFFSGWAATACLSGAIIWIEMRARSHRHHSGLADAMIHQAIEQFLPAGVAGALLALTLWKFAPETLWMLPGLWQILVSLGIFASVRSLPRSVAFVGAWYFVAGFAVLALASANHALSPWTMGLPFMVGQLLMAAFVHFASGEIDAEG GT:EXON 1|1-205:0| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| TM:NTM 6 TM:REGION 30->51| TM:REGION 59->79| TM:REGION 100->122| TM:REGION 127->149| TM:REGION 151->173| TM:REGION 179->201| SEG 30->43|talaataglalita| SEG 103->116|lpagvagallaltl| HM:PFM:NREP 1 HM:PFM:REP 101->152|PF07254|0.00056|38.8|49/132|DUF1434| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----11-------------11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-4,201-206| PSIPRED ccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccc //