[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37300.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->104 1ub9A PDBj 2e-07 31.0 %
:RPS:PDB   25->83 1bibA PDBj 8e-06 19.0 %
:RPS:SCOP  16->105 2eshA1  a.4.5.61 * 2e-07 21.1 %
:HMM:SCOP  9->113 2p4wA1 a.4.5.64 * 4.6e-13 29.0 %
:HMM:PFM   24->69 PF01022 * HTH_5 3.5e-08 38.6 44/47  
:BLT:SWISS 18->103 Y432_METJA 7e-08 36.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37300.1 GT:GENE ABE37300.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 70717..71097 GB:FROM 70717 GB:TO 71097 GB:DIRECTION + GB:PRODUCT transcriptional regulator, ArsR family GB:PROTEIN_ID ABE37300.1 GB:DB_XREF GI:91680998 InterPro:IPR001845 LENGTH 126 SQ:AASEQ MPKAEANNAPFSYDGLDRVIHEKARLGLLASLMAHPKGLAFADLKKLCGLTDGNLSRHLQVLQEAGLVDVIKGYEGNRPHTFCRLTKTGRRRFLDYLAVLEQLVRDAAKAAGQDDAAPTRLGILPA GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 18->103|Y432_METJA|7e-08|36.6|82/100| SEG 106->117|daakaagqddaa| BL:PDB:NREP 1 BL:PDB:REP 19->104|1ub9A|2e-07|31.0|84/100| RP:PDB:NREP 1 RP:PDB:REP 25->83|1bibA|8e-06|19.0|58/294| HM:PFM:NREP 1 HM:PFM:REP 24->69|PF01022|3.5e-08|38.6|44/47|HTH_5| RP:SCP:NREP 1 RP:SCP:REP 16->105|2eshA1|2e-07|21.1|90/114|a.4.5.61| HM:SCP:REP 9->113|2p4wA1|4.6e-13|29.0|100/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 63 OP:NHOMOORG 53 OP:PATTERN -------------------------11----------------------------------------- -11-1---11--------------------------------------------------------------------------------21-1-1---1-1-1-11111---------------11-11111--11-------------------------------------------------11-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--133--------222-----121------------11111111-1----------------1-2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 83.3 SQ:SECSTR HHHHHHHHHHcTTHTcEEccHHHHHHHHHHHHTTcccEccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccEEcccccHHHHHHHHHHHHHcT##################### DISOP:02AL 1-8| PSIPRED cccccHHccHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //