[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37313.1
DDBJ      :             Peptidoglycan-binding domain 1
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.20.1
:384 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  196->261 1lbuA1  a.20.1.1 * 4e-07 22.7 %
:HMM:SCOP  184->254 1lbuA1 a.20.1.1 * 1.4e-07 28.2 %
:RPS:PFM   72->180 PF06282 * DUF1036 3e-11 34.5 %
:RPS:PFM   205->248 PF01471 * PG_binding_1 8e-04 40.9 %
:RPS:PFM   262->377 PF06282 * DUF1036 2e-15 45.2 %
:HMM:PFM   73->180 PF06282 * DUF1036 1.7e-20 30.8 104/115  
:HMM:PFM   262->381 PF06282 * DUF1036 1.6e-30 36.0 111/115  
:HMM:PFM   202->243 PF01471 * PG_binding_1 3.3e-08 33.3 42/57  
:BLT:SWISS 205->265 OPCA_SYNY3 7e-06 34.4 %
:REPEAT 2|35->190|224->382

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37313.1 GT:GENE ABE37313.1 GT:PRODUCT Peptidoglycan-binding domain 1 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 88816..89970 GB:FROM 88816 GB:TO 89970 GB:DIRECTION + GB:PRODUCT Peptidoglycan-binding domain 1 GB:PROTEIN_ID ABE37313.1 GB:DB_XREF GI:91681011 InterPro:IPR002477 LENGTH 384 SQ:AASEQ MTGAKATSSCPGRGAARSAAPQTRDPGSAEPHKPGPRIISAPRREGRRAALHPGHACLFVATLLASLAGNTAAHADLKLCNRMSYVIETAIGIDDKATTATRGWLRIDPAQCRVVLQGALSADRVMLHARALAVYGASPIPQNGTDRLCITPENFVIAAARQCRSGQTLAPFTEIKPTQQDDGNMVAYLAEDSEYDDEQARLAAIQRLLVIAGYDAAPIDGVDGPKTQAALAAFLKSRGLKPDIVSAPDFFDTMIKAVESPSATGLTWCNDTRSRIMAAIAEDDGKTITSRGWYRIEPGKCLRPDLSALPKRVFSFAEAVDGNARPITLKDKPLNWGGATLLCTRESKFEISEQGDCSARGLNATGFAPVDLSGGGKTVRFATP GT:EXON 1|1-384:0| BL:SWS:NREP 1 BL:SWS:REP 205->265|OPCA_SYNY3|7e-06|34.4|61/475| NREPEAT 1 REPEAT 2|35->190|224->382| RP:PFM:NREP 3 RP:PFM:REP 72->180|PF06282|3e-11|34.5|105/111|DUF1036| RP:PFM:REP 205->248|PF01471|8e-04|40.9|44/56|PG_binding_1| RP:PFM:REP 262->377|PF06282|2e-15|45.2|104/111|DUF1036| HM:PFM:NREP 3 HM:PFM:REP 73->180|PF06282|1.7e-20|30.8|104/115|DUF1036| HM:PFM:REP 262->381|PF06282|1.6e-30|36.0|111/115|DUF1036| HM:PFM:REP 202->243|PF01471|3.3e-08|33.3|42/57|PG_binding_1| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF01471|IPR002477| RP:SCP:NREP 1 RP:SCP:REP 196->261|1lbuA1|4e-07|22.7|66/83|a.20.1.1| HM:SCP:REP 184->254|1lbuA1|1.4e-07|28.2|71/83|a.20.1.1|1/1|PGBD-like| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111---12111-------------------1--1-------------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-45,378-378,381-385| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEEEEEEEEcccccEEEEEEEEcccccEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEcccEEEEEcccccccccccccEEEcccccccccEEEEEcccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccEEcHHHHHHHHccccccccccEEEccccccEEEEEEEEEcccccEEEEEEEEcccccEEEEccccccEEEEEEEEcccccccEEcccccccccccEEEEEEccEEEEEEEccHHHHHHHHcccEEEEccccccEEEEccc //