[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37326.1
DDBJ      :             conserved hypothetical protein 103
Swiss-Prot:Y086_RHOPS   RecName: Full=UPF0133 protein RPD_0086;

Homologs  Archaea  0/68 : Bacteria  160/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->57 1pugB PDBj 1e-07 51.2 %
:BLT:PDB   28->71 1j8bA PDBj 1e-04 43.9 %
:RPS:SCOP  37->94 1j8bA  d.222.1.1 * 7e-11 29.8 %
:HMM:SCOP  8->102 1pugA_ d.222.1.1 * 1.6e-31 56.0 %
:RPS:PFM   8->94 PF02575 * DUF149 7e-11 46.0 %
:HMM:PFM   8->100 PF02575 * DUF149 2.5e-35 55.9 93/93  
:BLT:SWISS 1->94 Y086_RHOPS 6e-39 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37326.1 GT:GENE ABE37326.1 GT:PRODUCT conserved hypothetical protein 103 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(101293..101613) GB:FROM 101293 GB:TO 101613 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein 103 GB:PROTEIN_ID ABE37326.1 GB:DB_XREF GI:91681024 InterPro:IPR004401 LENGTH 106 SQ:AASEQ MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGSSGGGLVQVRMSAKMEVRGVSIDPSLLKPDEGGVLEDLLVAAHADAHRKAEAAMQEKMQALTGGLGLPPGLGLG GT:EXON 1|1-106:0| SW:ID Y086_RHOPS SW:DE RecName: Full=UPF0133 protein RPD_0086; SW:GN OrderedLocusNames=RPD_0086; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|Y086_RHOPS|6e-39|100.0|94/106| SEG 73->85|aahadahrkaeaa| SEG 95->105|gglglppglgl| BL:PDB:NREP 2 BL:PDB:REP 15->57|1pugB|1e-07|51.2|43/74| BL:PDB:REP 28->71|1j8bA|1e-04|43.9|41/85| RP:PFM:NREP 1 RP:PFM:REP 8->94|PF02575|7e-11|46.0|87/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 8->100|PF02575|2.5e-35|55.9|93/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 37->94|1j8bA|7e-11|29.8|57/92|d.222.1.1| HM:SCP:REP 8->102|1pugA_|1.6e-31|56.0|91/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 160 OP:NHOMOORG 160 OP:PATTERN -------------------------------------------------------------------- -----1-------------------------------------------------------------------------------------------------------------------------------------------1--------------------1--1------------------11-1-----------------------------------------------------------------------------------------------------------------------------------1---------------1------------------------------------------1-11111111111111111111-1111-11-11-111111111111111111111--1111111-1111111111-1111--1------------------------------111-1111111----1-----11-1-------1-------11-1111111111111111-11111111111111---------1--1111----------11-1-----------------------------11---------11--------111-----------1-1-----------------------------------------------------------------------------1---------------------------1-1-------------------------1--------------1-----------------1111111-11----------1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 50.9 SQ:SECSTR ##############ccccTTTHHHHHHcEEEEEEGGGTEEEEEETTccEEEEEEcGGG###GccHHHHHHH################################### DISOP:02AL 1-14,78-94,106-107| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccEEEEEEEccccEEEEEEcHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //