[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37331.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  36/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   21->205 1ejeA PDBj 1e-20 20.0 %
:RPS:SCOP  21->205 1ejeA  b.45.1.2 * 6e-21 20.0 %
:HMM:SCOP  19->204 1ejeA_ b.45.1.2 * 1.3e-26 30.0 %
:RPS:PFM   62->166 PF01613 * Flavin_Reduct 8e-07 35.6 %
:HMM:PFM   23->176 PF01613 * Flavin_Reduct 1.8e-16 21.2 132/155  
:BLT:SWISS 26->196 Y574_METTH 9e-06 30.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37331.1 GT:GENE ABE37331.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(106399..107100) GB:FROM 106399 GB:TO 107100 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37331.1 GB:DB_XREF GI:91681029 LENGTH 233 SQ:AASEQ MTLAARKDLRLSSQIIDPAILYFGTPVVLIGSCNDDDSFNLAPMSSAWWVGQRCMLGLASNSKTTGNILRSGECVLNLPSSDLVGAVDRLARTTGSDPVPQGKLHRGYRFEADKFGVSRLTSQKGDAVAAPRALECPVQIEARLMQAHPMAEEDVVWRGHLVALELSVVRIHVHPSIMMDGQDDRIDPDKWRPLIMSFQQYYGLALGRLQHSVLGEIPEAYYRPPSRPSQPAG GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 26->196|Y574_METTH|9e-06|30.3|152/100| RP:PDB:NREP 1 RP:PDB:REP 21->205|1ejeA|1e-20|20.0|160/192| RP:PFM:NREP 1 RP:PFM:REP 62->166|PF01613|8e-07|35.6|90/150|Flavin_Reduct| HM:PFM:NREP 1 HM:PFM:REP 23->176|PF01613|1.8e-16|21.2|132/155|Flavin_Reduct| RP:SCP:NREP 1 RP:SCP:REP 21->205|1ejeA|6e-21|20.0|160/192|b.45.1.2| HM:SCP:REP 19->204|1ejeA_|1.3e-26|30.0|160/192|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 53 OP:NHOMOORG 49 OP:PATTERN --------------------------------------------------------------1----- ----2--------------------------------------------1-------1--11----1--1------------------------------1------1-----------------------------------------------------------------------------------------------------1211-1----------------2-------------------------------------------1----------------------------------------------------------------------1-------------------------1---------------11-----1-------------------------------------------------------------------------------------------------------------11111------11--------1---------------------------------------------------------------------------------------------------------1------------------------------------------11------------------------------------11-------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------- --------------------11-----11--------------111--12-1-1--------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 85.4 SQ:SECSTR GGccHHHHHHHHHcccccccTcccEEcEEEEEEcTTccEEEEEEccEEEEETTEEEEEcTTcHHHHHHHHHcEEEEEEccGGGHHHHHHTTccccTT#######HHTTTcTccHHHHHTccEEccccccccEETTccEEEEEEEEEEEEETTEEEEccEEEEEEEEEEEEEEEcTTcEETT#TcEEcHHHHccEEEEETTEEEEccc########################## DISOP:02AL 1-4,6-6,223-234| PSIPRED ccccHHHHHHHHccEEccccccccccEEEEEEEcccccEEEcHHEEEEEccccEEEEEEcccHHHHHHHHHccEEEEEccHHHHHHHHHHHHHcccccccccHHcccccccccHHHHcccccccccEEcccccccccEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEcHHHHcccccccccHHHHcEEEEEcccccccccccEEccEEccccHHHHccccccccccc //