[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37335.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  85/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:241 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->104 PF05942 * PaREP1 4.6e-05 25.5 51/115  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37335.1 GT:GENE ABE37335.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(109382..110107) GB:FROM 109382 GB:TO 110107 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37335.1 GB:DB_XREF GI:91681033 LENGTH 241 SQ:AASEQ MRNGQNNKRLRNRNSGSNNNNNNNNNRRGQNPMTRVFESNGPDIKIRGTASHVAEKYVQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQPQQQQRVDNDMSDNDDEGEADYSNFGAEPGLVPVQQQPYQPREQPRAEQPQFAPREQPQPREHRPQPQFTPRAEQPQPSVEAVDRLPSFITGPQPQISPAAFEGAGGAERFPPRRRRRPHVPRGEGAAAAAPVPAEDATPGNE GT:EXON 1|1-241:0| SEG 6->31|nnkrlrnrnsgsnnnnnnnnnrrgqn| SEG 91->103|qeqfrqnqpqqqq| SEG 130->149|vpvqqqpyqpreqpraeqpq| SEG 152->166|preqpqprehrpqpq| SEG 198->221|aafegaggaerfpprrrrrphvpr| SEG 225->238|aaaaapvpaedatp| HM:PFM:NREP 1 HM:PFM:REP 53->104|PF05942|4.6e-05|25.5|51/115|PaREP1| OP:NHOMO 85 OP:NHOMOORG 85 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111111111111111111-11--11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-32,92-117,135-177,212-222,233-242| PSIPRED cccccccHHHHccccccccccccccccccccccHHHHHccccccEEcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHccccccccccccHHHccccccHHccccccHHcccccccccccccccccHHHccccccccccccccHHHHHHHHcHHHHccccccccHHHHcccccccccccHHHccccccccccccccccccccccccccc //