[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37344.1
DDBJ      :             protein of unknown function DUF1178
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  121/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->167 PF06676 * DUF1178 1e-31 56.6 %
:HMM:PFM   1->167 PF06676 * DUF1178 6.3e-58 54.3 138/148  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37344.1 GT:GENE ABE37344.1 GT:PRODUCT protein of unknown function DUF1178 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(120224..120727) GB:FROM 120224 GB:TO 120727 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1178 GB:PROTEIN_ID ABE37344.1 GB:DB_XREF GI:91681042 InterPro:IPR009562 LENGTH 167 SQ:AASEQ MIRYNLRCECGHSFESWFQSSSAYDSQVRRKLVNCPACDSVKVEKAIMAPQIVGKKGRGRAPEPAHEVAAGTAVAPQAAESPVAESATPLLLAQERELRTKLKELRDYIVKTADNVGDSFPNEARKMHYGDIEHRPIFGEASPAEAKALIDEGIEVAPLPVLPEDRN GT:EXON 1|1-167:0| SEG 69->79|aagtavapqaa| RP:PFM:NREP 1 RP:PFM:REP 1->167|PF06676|1e-31|56.6|145/146|DUF1178| HM:PFM:NREP 1 HM:PFM:REP 1->167|PF06676|6.3e-58|54.3|138/148|DUF1178| OP:NHOMO 124 OP:NHOMOORG 121 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111112211111111111111111-11111111111-11111111111111111111111111111111111111-1211------------------------------1111-1111-1111111----1111------1-11-1--11-111-1111111---1-----------------11-1----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 52-65,80-85,88-88,165-168| PSIPRED cEEEEEEccccccccHHcccHHHHHHHHHccccccccccccEEEEEEcccHHcccccccccccHHHHHHccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccc //