[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37357.1
DDBJ      :             Putative threonine efflux protein-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->165 PF01810 * LysE 2e-05 34.7 %
:HMM:PFM   16->180 PF01810 * LysE 7.6e-10 27.3 165/192  
:BLT:SWISS 3->166 EAMB_SALTY 3e-10 26.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37357.1 GT:GENE ABE37357.1 GT:PRODUCT Putative threonine efflux protein-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 132778..133347 GB:FROM 132778 GB:TO 133347 GB:DIRECTION + GB:PRODUCT Putative threonine efflux protein-like GB:PROTEIN_ID ABE37357.1 GB:DB_XREF GI:91681055 InterPro:IPR001123 LENGTH 189 SQ:AASEQ MTTQMSYEAFVLTSLLILLTPGPTNTLLAASGAAMGVRKALWLALAEALGYSIAISLFVAAAGALEDVPIALPLLKAVAAGWLLFSAVQLWTRPATPDRADQRGAFSRVCVTTMLNPKAMLVGTVIIPDVTIGQAQAVLTFVVLSSVAGAGWIVSGAALPAGLRRYSFKSAAVIIAAFSFAAAASAVQG GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 3->166|EAMB_SALTY|3e-10|26.2|164/195| TM:NTM 5 TM:REGION 3->25| TM:REGION 41->63| TM:REGION 70->91| TM:REGION 131->153| TM:REGION 167->189| SEG 171->187|aaviiaafsfaaaasav| RP:PFM:NREP 1 RP:PFM:REP 15->165|PF01810|2e-05|34.7|150/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 16->180|PF01810|7.6e-10|27.3|165/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 58 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1------------------------------1-1------------1-----------------------------------------------------------11------111------111111-1111---1---11----------------------------------------------------------------------------------------------------1------------------------------------1---------------------------------------11--------------------------------------------------------1---------------3333323--------1---21111--1-2------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 94-104,188-190| PSIPRED cccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //