[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37384.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->99 PF00161 * RIP 9.7e-05 26.7 60/205  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37384.1 GT:GENE ABE37384.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 161969..162517 GB:FROM 161969 GB:TO 162517 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37384.1 GB:DB_XREF GI:91681082 LENGTH 182 SQ:AASEQ MKRRRNFGGRRRLPKVDGETNHNGGLSAPDEKTAALARAFDSAWERFIATEGAEADTDANRKRLASKIVALSRAGEADEDRLAQSGLIHLSVLAEAARLGSQPPAPTNGIGTSQQATHAQAFSPQTVAAMSAALEQCVETLPLQTPSSALQFLSARILEQASRGEHDPERLSRHALEALRNR GT:EXON 1|1-182:0| SEG 3->12|rrrnfggrrr| HM:PFM:NREP 1 HM:PFM:REP 40->99|PF00161|9.7e-05|26.7|60/205|RIP| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,101-103,106-109,160-170,181-183| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcc //