[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37407.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37407.1 GT:GENE ABE37407.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 191512..191937 GB:FROM 191512 GB:TO 191937 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37407.1 GB:DB_XREF GI:91681105 LENGTH 141 SQ:AASEQ MNAPARSHARRFFPGITRTGLLAAAALLAALVAASGDAEAAKRRAGGNFDGVWNVVFATRAGNCGPTYNAPFAVQGRRVSSAGGGKVTGGITGGGNVAVRLSVGASVANGRGRLAGNSGTGTWSGLIEGDRCSGTWQATRG GT:EXON 1|1-141:0| SEG 21->41|llaaaallaalvaasgdaeaa| SEG 83->95|gggkvtggitggg| OP:NHOMO 13 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2211--2112------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,138-142| PSIPRED ccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccEEEEEEEEccccccccEEEEEEEEccEEEEccccEEEEEEccccEEEEEEEEEEEEEccccEEEEEccccEEEEEEccccccEEEEEccc //