[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37416.1
DDBJ      :             OstA-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->93 2r1aH PDBj 5e-04 42.9 %
:RPS:PFM   41->183 PF03968 * OstA 3e-10 37.0 %
:HMM:PFM   19->184 PF03968 * OstA 2.6e-34 35.4 130/145  
:HMM:PFM   199->210 PF08515 * TGF_beta_GS 6.6e-05 66.7 12/29  
:BLT:SWISS 44->196 Y383_RHIME 5e-22 40.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37416.1 GT:GENE ABE37416.1 GT:PRODUCT OstA-like protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 200078..200743 GB:FROM 200078 GB:TO 200743 GB:DIRECTION + GB:PRODUCT OstA-like protein GB:PROTEIN_ID ABE37416.1 GB:DB_XREF GI:91681114 InterPro:IPR005653 LENGTH 221 SQ:AASEQ MTNARCLLARRKLLAIAGAAFLAGSANLSGALAQSAVQGVPNAMQGFSQNRDQPIQIESDTLEVRDKKKEATFTGSVKVVQGDTTMTSKTLVVFYDQDQSETSAKQAKRKAMPAAAPGPGGTSSIRRLEAKGNVVVTQKDQVVTGDSAVFDTKTNLVTMLGSVVLTQGKNVVRGDRLLVDMTTGVSRVESNSGRVQGLFQSSGSGSGAPLGIGPPPAGQKK GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 44->196|Y383_RHIME|5e-22|40.9|137/186| SEG 4->36|arcllarrkllaiagaaflagsanlsgalaqsa| SEG 104->121|akqakrkampaaapgpgg| SEG 201->218|ssgsgsgaplgigpppag| BL:PDB:NREP 1 BL:PDB:REP 52->93|2r1aH|5e-04|42.9|42/131| RP:PFM:NREP 1 RP:PFM:REP 41->183|PF03968|3e-10|37.0|138/159|OstA| HM:PFM:NREP 2 HM:PFM:REP 19->184|PF03968|2.6e-34|35.4|130/145|OstA| HM:PFM:REP 199->210|PF08515|6.6e-05|66.7|12/29|TGF_beta_GS| OP:NHOMO 68 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111-111111112111111111---1-1------11111111111-111111111-11111--11111111-1--------------1-------------------------------111-1-----------------------------------------------------------------------------1-----------11----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 42 STR:RPRED 19.0 SQ:SECSTR ###################################################GccEEEEccEEEccTTTTEEEEEEEEEEEETTccEEEEEEEE################################################################################################################################ DISOP:02AL 1-3,98-121,188-189,212-214,216-222| PSIPRED cccccEEEEEEEEEEEEcHHEEcccccccHHHHHHHHcccccEEEEEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEccEEEEEEEEEEEEccccccHHHHHHHHHccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEEEEcccEEEEEEEEEEEEccEEEEcccccEEEEEEEccccccccccccccccccccc //