[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37420.1
DDBJ      :             PTS IIA-like nitrogen-regulatory protein PtsN
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  544/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.112.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->145 1a6jB PDBj 3e-24 41.3 %
:RPS:PDB   3->145 2a0jA PDBj 4e-28 33.6 %
:RPS:SCOP  1->145 1a6jA  d.112.1.1 * 2e-24 36.6 %
:HMM:SCOP  1->145 1hynP_ d.112.1.2 * 2.9e-42 39.3 %
:RPS:PFM   16->145 PF00359 * PTS_EIIA_2 1e-16 39.1 %
:HMM:PFM   7->145 PF00359 * PTS_EIIA_2 1.5e-37 38.7 137/142  
:BLT:SWISS 1->153 PTSN_BRAJA 3e-61 82.4 %
:PROS 51->67|PS00372|PTS_EIIA_TYPE_2_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37420.1 GT:GENE ABE37420.1 GT:PRODUCT PTS IIA-like nitrogen-regulatory protein PtsN GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 204510..204971 GB:FROM 204510 GB:TO 204971 GB:DIRECTION + GB:PRODUCT PTS IIA-like nitrogen-regulatory protein PtsN GB:PROTEIN_ID ABE37420.1 GB:DB_XREF GI:91681118 InterPro:IPR002178 InterPro:IPR006320 LENGTH 153 SQ:AASEQ MTITDLVAPEAVIPALKVISKKQALQELSARAAELSGQNERAVFEVLLQREKLGTTAVGYGVAIPHGKLPKLERLFGLFARLERPIDFEAMDGQPVDLIFLLLAPEGAGADHLKALARIARLLRDQDVAKKLRASRDAQAIYSVLALPPATVA GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 1->153|PTSN_BRAJA|3e-61|82.4|153/153| PROS 51->67|PS00372|PTS_EIIA_TYPE_2_HIS|PDOC00528| SEG 115->124|alariarllr| BL:PDB:NREP 1 BL:PDB:REP 20->145|1a6jB|3e-24|41.3|126/157| RP:PDB:NREP 1 RP:PDB:REP 3->145|2a0jA|4e-28|33.6|143/146| RP:PFM:NREP 1 RP:PFM:REP 16->145|PF00359|1e-16|39.1|128/142|PTS_EIIA_2| HM:PFM:NREP 1 HM:PFM:REP 7->145|PF00359|1.5e-37|38.7|137/142|PTS_EIIA_2| GO:PFM:NREP 3 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00359|IPR002178| GO:PFM GO:0006810|"GO:transport"|PF00359|IPR002178| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00359|IPR002178| RP:SCP:NREP 1 RP:SCP:REP 1->145|1a6jA|2e-24|36.6|145/150|d.112.1.1| HM:SCP:REP 1->145|1hynP_|2.9e-42|39.3|145/293|d.112.1.2|1/1|Phoshotransferase/anion transport protein| OP:NHOMO 681 OP:NHOMOORG 546 OP:PATTERN ------------------------1------------------------------------------- -----1-1----1--------1---1------1111-1-------------11-1--------2--------------1--1--------------------------1--11111122222221-11-1111111-------------------------------------------------------112111111112111111212222111211-1113232331-111111-111111111111111-1331-11211--251111--111111111111111111111111111111111111111111-111111-11-------1-1-3---111---111-------------122111121-1111111111121111122121111111111111-11111212111-211122122211111111111111111-------------111------------------------------1111111111112121111111112111111211111111111111111111111211---11111111111-112-212-111-11111--2--1121122121111-------------------------11111111111111111111111111111111---1112------21111113222322243-2334332414222333334111111111211111111111111132133231-111111111111--11----------1111111111111111111----------1111111211111111111----------111111111122121111111111----------1111--------2-------------1------------------1------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 95.4 SQ:SECSTR HHHHHHccGGGEEEEEccccHHHHHHHHHHHHccTTcccHHHHHHHHHHHHTTccccccccEEccEEEETTccccEEEEEEEEEEEccccTTcccEEEEEEEEEEcccHHHHHHHHHHHHHHHTcHHHHHHHHHcccHHHHHHHHT####### DISOP:02AL 149-154| PSIPRED ccHHHcccHHHEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccEEccccccccccccEEEEEEEccccccccccccEEEEEEEEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHcccHHccc //