[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37424.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  559/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   73->277 2r6gG PDBj 6e-14 27.1 %
:RPS:PDB   13->176 3b8eA PDBj 8e-05 10.6 %
:RPS:PDB   168->207 3dhwA PDBj 4e-07 32.5 %
:RPS:SCOP  10->277 2r6gG1  f.58.1.1 * 9e-24 23.6 %
:HMM:PFM   93->277 PF00528 * BPD_transp_1 1.2e-19 18.4 179/185  
:BLT:SWISS 1->282 UGPE_YERPS 6e-90 61.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37424.1 GT:GENE ABE37424.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(207468..208316) GB:FROM 207468 GB:TO 208316 GB:DIRECTION - GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABE37424.1 GB:DB_XREF GI:91681122 InterPro:IPR000515 LENGTH 282 SQ:AASEQ MVEHRKFGNLLPHLVLWTGVLIVAFPVYIAFVASTQDNATIANGQMSLLPGGHFLETYYKTLFVGTSGTTREPVGTMLFNSFVMAMMIAVGKIAISLISAYAIVYFRFPFRMTIFWLIFITLMLPVEVRIYPTYKIVADLHLLDSYAGLTLPLIASATATLLFRQFFMTVPDELLEASRIDGAGPFRFFWDTLLPLSRTNMAALFVILFILGWNQYLWPLLITTRDDMQTIQIGIRKMIVTSDALTEWPVVMATAILAMLPPVAVVVLMQKLFVRGLVETEK GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 1->282|UGPE_YERPS|6e-90|61.9|281/281| TM:NTM 6 TM:REGION 11->33| TM:REGION 79->101| TM:REGION 112->134| TM:REGION 143->165| TM:REGION 201->223| TM:REGION 253->275| SEG 257->269|lamlppvavvvlm| BL:PDB:NREP 1 BL:PDB:REP 73->277|2r6gG|6e-14|27.1|203/284| RP:PDB:NREP 2 RP:PDB:REP 13->176|3b8eA|8e-05|10.6|142/998| RP:PDB:REP 168->207|3dhwA|4e-07|32.5|40/203| HM:PFM:NREP 1 HM:PFM:REP 93->277|PF00528|1.2e-19|18.4|179/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 10->277|2r6gG1|9e-24|23.6|263/284|f.58.1.1| OP:NHOMO 2908 OP:NHOMOORG 591 OP:PATTERN 11--3--12222233-41211---51131-1------------------------13---1321---- ---1d1-1222-1-23344-4133464444431222-4464437F*Z2AFE3NJM12A--8679C4CLSG58555GDA----3-----------------------------------------------------89978---66221311-11221111111121333--1-----1----BD255DF-953222222331122222QF994722354928347787779*111111111111111-1---421-22--21133--22---1-42542325334411555666655554333344443333355---5553G4-371111121313C2---334b-23233C--231--1I--1655I2-1-------111112-A761--424424457466666D---5--4-18O--TTTHXVNjgXNL22---6D76646A74--------2112--11-----------------------------1---2-144436887765344444785554346562223--1127-233326669----1--3--------------1-2----1--11111---------22-223----------1------------------125-----1-5------------1---------1---------26651413333333333-33333334333323333325556611123222222222222226-1133321-488888888888---------11111-56C---111--------1----------1-11112222211122545----------111-222223154411111111111111--------------------511111-11-1111111---11----6HEA79Q8B9-2- -------------2------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 92.6 SQ:SECSTR ############TccHHHHHHHHHH##HHHHHHHHHHHcccccccccccccccccccccTHHHHTTTTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccTTcccHHHHHHHHHHHHHHHcTTGGGcccccccTTTTTTTTHHHHTHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccHHHHGGGGccccccc##HHHHHHHHHHTHHHHHHHHHHHTTTccccc##### DISOP:02AL 1-2,281-283| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //