[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37438.1
DDBJ      :             tryptophan synthase, alpha chain
Swiss-Prot:TRPA_RHOPS   RecName: Full=Tryptophan synthase alpha chain;         EC=4.2.1.20;

Homologs  Archaea  35/68 : Bacteria  737/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->246 2ekcA PDBj 1e-40 39.1 %
:RPS:PDB   4->271 3cepA PDBj 7e-36 31.1 %
:RPS:SCOP  17->264 1geqA  c.1.2.4 * 3e-35 39.4 %
:HMM:SCOP  2->267 1xcfA_ c.1.2.4 * 7.6e-91 49.2 %
:RPS:PFM   9->268 PF00290 * Trp_syntA 4e-61 51.8 %
:HMM:PFM   9->254 PF00290 * Trp_syntA 2e-94 49.8 245/259  
:BLT:SWISS 1->278 TRPA_RHOPS e-137 100.0 %
:PROS 49->62|PS00167|TRP_SYNTHASE_ALPHA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37438.1 GT:GENE ABE37438.1 GT:PRODUCT tryptophan synthase, alpha chain GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 221783..222619 GB:FROM 221783 GB:TO 222619 GB:DIRECTION + GB:PRODUCT tryptophan synthase, alpha chain GB:PROTEIN_ID ABE37438.1 GB:DB_XREF GI:91681136 InterPro:IPR002028 InterPro:IPR003009 LENGTH 278 SQ:AASEQ MTTRIDTRFAELKKQGRSAFVTFVMAGDPDLATSLQVLKALPAAGADIIEIGMPFTDPMADGPAIQAAGLRALHSGATLSHTLGLVRDFRKDDDTTPMVLMGYYNPIYIYGVDAFLADAKAAGVDGLIIVDLPPEEDSELCLPAMKAGLNFIRLATPTTDEKRLPAVLANTSGFVYYVSITGITGSASADSAAVGDAVARIKRHTDLPVCVGFGIRTPEAARAIAAEADGAVVGSALIDALQKSLDADNRATKATVGAVADLVASLAAGVRGAKQAAE GT:EXON 1|1-278:0| SW:ID TRPA_RHOPS SW:DE RecName: Full=Tryptophan synthase alpha chain; EC=4.2.1.20; SW:GN Name=trpA; OrderedLocusNames=RPD_0198; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Lyase; Tryptophan biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->278|TRPA_RHOPS|e-137|100.0|278/278| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| PROS 49->62|PS00167|TRP_SYNTHASE_ALPHA|PDOC00151| SEG 185->199|gsasadsaavgdava| SEG 220->231|aaraiaaeadga| BL:PDB:NREP 1 BL:PDB:REP 4->246|2ekcA|1e-40|39.1|235/253| RP:PDB:NREP 1 RP:PDB:REP 4->271|3cepA|7e-36|31.1|264/266| RP:PFM:NREP 1 RP:PFM:REP 9->268|PF00290|4e-61|51.8|253/255|Trp_syntA| HM:PFM:NREP 1 HM:PFM:REP 9->254|PF00290|2e-94|49.8|245/259|Trp_syntA| GO:PFM:NREP 2 GO:PFM GO:0004834|"GO:tryptophan synthase activity"|PF00290|IPR002028| GO:PFM GO:0006568|"GO:tryptophan metabolic process"|PF00290|IPR002028| RP:SCP:NREP 1 RP:SCP:REP 17->264|1geqA|3e-35|39.4|236/241|c.1.2.4| HM:SCP:REP 2->267|1xcfA_|7.6e-91|49.2|266/0|c.1.2.4|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 932 OP:NHOMOORG 889 OP:PATTERN -----------------------11-111111111111111111111111111111--1-------11 1111111111111111111-11111111111111111111121111111111111111--111111111111111111----111111111111---111-111111111-1111-1-11-----11111111111111111111111211112111111111111112211111111111111111111-11111111111-111111111111111111111111111111-1111111111111111111----11-----11--11----1-111-------11111111111111-------------1--111----11-11----------1-11----1-1--11111111111--1111111-11111111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111-1111111111111111111111111111111111111111111111-11111111111-11111111111111111111111111111-1111111111111111111111111111111111111111111111---111111-11111111111111111111-1111111111111112111111111111111111111111111111111111-11111111111111-1111-1111111212111111-11111-111111111111111111111111111111111111111111111111111111111111111111111111-111111--------------------------------------1--1-111111 ------1-----11111111122343311-11111112111111-11111111111111211111111-1111111111111111111-11111111111-21112-11-------------------------------------------------1--------------1-11118111111442122112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 100.0 SQ:SECSTR TcHHHHHHHHHHHHTTccEEEEEEETTcccHHHHHHHHHHHHHTTcccEEEEccccccTTccHHHHHHHHHHHHTTccHHHHHHHHHHHHHHcccccEEEEEcHHHHHTTcHHHHHHHHHHHTccEEEETTccGGGcHHHHHHHHHTTcEEEcEEcTTccHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHTTcccEEEEcccccHHHHHHHHHTTccEEEcHHHHHHHHHTTTTTcTcHHHHHHHHHHHHHHHHHTTcTccHHHH DISOP:02AL 1-2,274-279| PSIPRED ccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEHHHHHHHHccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //