[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37459.1
DDBJ      :             ferric uptake regulator, Fur family
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  113/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->161 1mzbA PDBj 5e-11 31.5 %
:RPS:PDB   36->111 2co5B PDBj 1e-05 18.1 %
:RPS:SCOP  32->161 1mzbA  a.4.5.42 * 1e-15 29.5 %
:HMM:SCOP  31->162 1mzbA_ a.4.5.42 * 6.3e-27 30.3 %
:RPS:PFM   41->135 PF01475 * FUR 1e-11 38.7 %
:HMM:PFM   40->154 PF01475 * FUR 1e-22 25.4 114/120  
:BLT:SWISS 34->161 FUR_PSEAE 1e-11 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37459.1 GT:GENE ABE37459.1 GT:PRODUCT ferric uptake regulator, Fur family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(251081..251569) GB:FROM 251081 GB:TO 251569 GB:DIRECTION - GB:PRODUCT ferric uptake regulator, Fur family GB:PROTEIN_ID ABE37459.1 GB:DB_XREF GI:91681157 InterPro:IPR002481 LENGTH 162 SQ:AASEQ MDIGDRATYSREESVTLAHAVEPHLNGCPWHDVNEMLQSVGLRPTRQRMALGWLLFSKGDRHLTAEMLYEEASQAKVPVSLATVYNTLNQLTDVGLLRQVSVDGTKTYFDTNVTAHQHFYLENNHELIDIPDQHVALRSTPQVPDGYEIARVDVVVRLRKKS GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 34->161|FUR_PSEAE|1e-11|31.2|128/134| BL:PDB:NREP 1 BL:PDB:REP 34->161|1mzbA|5e-11|31.5|127/133| RP:PDB:NREP 1 RP:PDB:REP 36->111|2co5B|1e-05|18.1|72/94| RP:PFM:NREP 1 RP:PFM:REP 41->135|PF01475|1e-11|38.7|93/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 40->154|PF01475|1e-22|25.4|114/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 32->161|1mzbA|1e-15|29.5|129/133|a.4.5.42| HM:SCP:REP 31->162|1mzbA_|6.3e-27|30.3|132/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 146 OP:NHOMOORG 123 OP:PATTERN -------111111111-1-------------------------------------------------- -------------------------------------------------------------1---------------------11--1------------------1---------------------------------------2--------11---------1----------------1-------1----------------------------------------------------------------------------------1-------------------------------------------------------------------------------1---1-------1-------------11111142221112111322222222221-11111111111-111111121111211--11-1111111-------------211-----------------------------1---------------------------------------------------------1----------------------------------------1--------------------------------1-11--1--1----------------------------111------------------------------------------------------------------------------------------------------------------------------------1-11111---111111---------------------------------------------111111------------------------------------------1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 80.2 SQ:SECSTR ###############################cHHHccTTccHHHHHHHHHHHHHHHHTTTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEEEccccccEEEEETTTccEEEEccHHHHHHHHHHHHTTccccccccEEEEccc# DISOP:02AL 1-3,17-24,162-163| PSIPRED ccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccEEEEEEccccccEEEEcccccEEEEccccccHHHHHHcccccEEEEEEEEEEEEEcc //