[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37460.1
DDBJ      :             3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
Swiss-Prot:FABA_RHOPS   RecName: Full=3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase;         EC=4.2.1.60;AltName: Full=Beta-hydroxydecanoyl thioester dehydrase;

Homologs  Archaea  0/68 : Bacteria  294/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->183 1mkaA PDBj 1e-64 63.3 %
:RPS:PDB   44->171 3dozD PDBj 6e-18 25.4 %
:RPS:SCOP  15->183 1mkaA  d.38.1.2 * 1e-60 63.3 %
:HMM:SCOP  14->184 1mkaA_ d.38.1.2 * 6.3e-57 43.3 %
:RPS:PFM   45->167 PF07977 * FabA 2e-15 47.8 %
:HMM:PFM   44->171 PF07977 * FabA 2.8e-50 49.6 127/138  
:BLT:SWISS 13->187 FABA_RHOPS e-104 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37460.1 GT:GENE ABE37460.1 GT:PRODUCT 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 251784..252347 GB:FROM 251784 GB:TO 252347 GB:DIRECTION + GB:PRODUCT 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase GB:PROTEIN_ID ABE37460.1 GB:DB_XREF GI:91681158 InterPro:IPR010083 InterPro:IPR013114 LENGTH 187 SQ:AASEQ MAEFRELKRQSRMRDRRSSYEYEDLLACGRGELFGPGNAQLPLPPMLMFDRITEISETGGAHGKGLIRAELDVNPDLWFFACHFKGDPVMPGCLGLDALWQMLGFFLGWSGGEGPGRALGSGELKFTGQVLPHVRKVVYNVDIKRVMRSKLWLGIADGWLSADDEIIYRAQDLKVGLFKQTAAKPAA GT:EXON 1|1-187:0| SW:ID FABA_RHOPS SW:DE RecName: Full=3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase; EC=4.2.1.60;AltName: Full=Beta-hydroxydecanoyl thioester dehydrase; SW:GN Name=fabA; OrderedLocusNames=RPD_0220; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Lyase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 13->187|FABA_RHOPS|e-104|100.0|175/175| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 15->183|1mkaA|1e-64|63.3|169/171| RP:PDB:NREP 1 RP:PDB:REP 44->171|3dozD|6e-18|25.4|118/149| RP:PFM:NREP 1 RP:PFM:REP 45->167|PF07977|2e-15|47.8|113/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 44->171|PF07977|2.8e-50|49.6|127/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 15->183|1mkaA|1e-60|63.3|169/171|d.38.1.2| HM:SCP:REP 14->184|1mkaA_|6.3e-57|43.3|171/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 328 OP:NHOMOORG 295 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1----------------------1-1--------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112222211111111111111111-111111111111111211111111111211111111111---------------------------------------------11--------------------------------------------1111----1----111----------------121-----------1111--1-1-----11----------------------------111-122111222222222222222222221-11111------11111111111111111-11111111111111111111111121111111111111111111111111111111111111111111111111----11111111111111111111----------1111111111111111111---------1111211111112111111111111111111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 90.4 SQ:SECSTR ##############cccccccHHHHHHHHTTccccHHHHccccTTcccccEEEEEETTTEEEcHHHHHEEEEcccccGGGGcccTTcccccHHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEcccccTTcEEEEEEEccEEEEEEETTEEEEEEEEEETTEEEEEEEEHHEEEEcccTT#### DISOP:02AL 1-14,181-188| PSIPRED ccHHHHHHHHHHHccccccccHHHHHHcccccccccccccccccccEEEEEEEEEEEccccccccEEEEEEEccccccEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEccEEccccEEEEEEEEEEEEccccEEEEEEEEEEEccEEEEEEEccEEEEEccccccccc //