[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37482.1
DDBJ      :             tRNA-i(6)A37 thiotransferase enzyme MiaB
Swiss-Prot:MIAB_RHOPS   RecName: Full=(Dimethylallyl)adenosine tRNA methylthiotransferase miaB;         EC=2.-.-.-;AltName: Full=tRNA-i(6)A37 methylthiotransferase;

Homologs  Archaea  67/68 : Bacteria  791/915 : Eukaryota  105/199 : Viruses  0/175   --->[See Alignment]
b.125.1b.40.4c.1.28
:473 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   158->350 2qgqA PDBj 7e-15 35.3 %
:RPS:PDB   55->393 3banB PDBj 2e-49 9.2 %
:RPS:SCOP  197->378 1iwmA  b.125.1.2 * 8e-37 13.7 %
:RPS:SCOP  381->457 1yezA1  b.40.4.12 * 3e-08 17.5 %
:HMM:SCOP  102->380 1oltA_ c.1.28.2 * 1.2e-61 29.4 %
:RPS:PFM   7->102 PF00919 * UPF0004 1e-17 42.2 %
:RPS:PFM   160->326 PF04055 * Radical_SAM 1e-11 39.3 %
:HMM:PFM   160->334 PF04055 * Radical_SAM 2.7e-32 34.6 159/166  
:HMM:PFM   6->109 PF00919 * UPF0004 2.9e-30 36.7 98/98  
:HMM:PFM   389->457 PF01938 * TRAM 3.9e-09 31.6 57/61  
:BLT:SWISS 1->473 MIAB_RHOPS 0.0 100.0 %
:PROS 160->180|PS01278|MTTASE_RADICAL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37482.1 GT:GENE ABE37482.1 GT:PRODUCT tRNA-i(6)A37 thiotransferase enzyme MiaB GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(280703..282124) GB:FROM 280703 GB:TO 282124 GB:DIRECTION - GB:PRODUCT tRNA-i(6)A37 thiotransferase enzyme MiaB GB:PROTEIN_ID ABE37482.1 GB:DB_XREF GI:91681180 InterPro:IPR002792 InterPro:IPR005839 InterPro:IPR006463 InterPro:IPR006638 InterPro:IPR007197 LENGTH 473 SQ:AASEQ MAPPRKLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADLVILNTCHIREKASEKVYSELGRLRLARDEAASSGRRMQIAVAGCVAQAEGEEIVRRAPVVDVVVGPQSYHHLPQLLARADQAGRALETEFPVEDKFGFLPQPRPETIRARGISAFVTVQEGCDKFCTFCVVPYTRGAEVSRPVSAIIDDVKRLADNGVREITLIGQNVNAYHGEGPDSRAWTLGRLLRRLAAVPGIVRLRYSTSHPNDVDDELIEAHRDLDALMPFVHLPVQSGSDPILAAMNRKHTAADYRRVIDRFRAVRPQIAFSSDFIVGFPGETEADFAATLALVTQIGYAGAYSFKYSPRPGTPAADMQEMVPAAVMDERLERLQQLIDSQQSAFNKAAIGQTVDVLFERAGRKPGQIVGRTAYLQPAHVFPGPMFLGPGMAPDSLVGQILPVRVDSLERYSLLGELAAKPPQHARPLAATGA GT:EXON 1|1-473:0| SW:ID MIAB_RHOPS SW:DE RecName: Full=(Dimethylallyl)adenosine tRNA methylthiotransferase miaB; EC=2.-.-.-;AltName: Full=tRNA-i(6)A37 methylthiotransferase; SW:GN Name=miaB; OrderedLocusNames=RPD_0242; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; S-adenosyl-L-methionine; Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->473|MIAB_RHOPS|0.0|100.0|473/473| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 160->180|PS01278|MTTASE_RADICAL|PDOC00984| SEG 103->108|vvdvvv| BL:PDB:NREP 1 BL:PDB:REP 158->350|2qgqA|7e-15|35.3|173/266| RP:PDB:NREP 1 RP:PDB:REP 55->393|3banB|2e-49|9.2|325/349| RP:PFM:NREP 2 RP:PFM:REP 7->102|PF00919|1e-17|42.2|90/97|UPF0004| RP:PFM:REP 160->326|PF04055|1e-11|39.3|150/164|Radical_SAM| HM:PFM:NREP 3 HM:PFM:REP 160->334|PF04055|2.7e-32|34.6|159/166|Radical_SAM| HM:PFM:REP 6->109|PF00919|2.9e-30|36.7|98/98|UPF0004| HM:PFM:REP 389->457|PF01938|3.9e-09|31.6|57/61|TRAM| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00919|IPR013848| GO:PFM GO:0009451|"GO:RNA modification"|PF00919|IPR013848| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF00919|IPR013848| GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 197->378|1iwmA|8e-37|13.7|168/177|b.125.1.2| RP:SCP:REP 381->457|1yezA1|3e-08|17.5|63/68|b.40.4.12| HM:SCP:REP 102->380|1oltA_|1.2e-61|29.4|262/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 2073 OP:NHOMOORG 963 OP:PATTERN 1112111111111111111111111111-111112322212122223322222322121221111111 2331311111111111111-111121111111111111112222211211111111111122222222222111111133331333333333233322233333333313-------22222223333333333332222222222222222222222222222222222222212222212222233443222222222222222222222222222222221-------3222222222222222222221----------------------------------------------------------------------33333333333333343333333333222332333334334333333321233212223323333332233333333333323333-3333333323212222222222223333233333333332222222222222333111222222222222222222222222221333332222222222222222222222222222222222222222222222222222222222111111122222233333333333333333333333322323233333333333333333333333333322222222212112222211122221211211111121211111122222112222222222-2222222222222222222222221122222222222222222122122221-111111111111---31111122223121122222222112222222232222222222221222211112222211122121211112222211122222222222211111133333333--------32-------------------2------3334333343222 1111112-1-11111----------------------------------------------------------------------------------------111-1314822222222221242252AR3-6262221522222212221242322111523212222-42423334T444442223-273352224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 451 STR:RPRED 95.3 SQ:SECSTR HHHHccccccccEEccEEEEEccTHTccGGGccHcccTTccHHHHHHHHHHHHTcEEEEEEEcccTTcHTcccEcEEcHcccHHHHHTcTTccEEEEccccccTTccccHHHHHHHHHHHHHTTcEEEEEEcccccHHHHHTcTTHHHHHHHHHHHHHHHHHTccEEEEcccccccccccccccccTTcccccEEccccccccccccHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHTTcEEEEEcccccccccTTcccccccHHHHHHHHHTcccTTEEEEEEHHHHTTcTTccHHHHHHHHcEEEEETTEEEEcGGGccccHHHHHHHHHHTTcEEEEEcccccccTTcccccGGGcHHHHHHHHHHHHHHHTTccccccccccccccEccccEEEEETTEEEEEcccccHHHEccTTccTTTcHHHHHHHHHHHHHccHHHHHHH###################### DISOP:02AL 1-3,464-464,466-474| PSIPRED cccccEEEEEEccccccHHHHHHHHHHHHHccccccccHHHccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccEEEEEEcccccccccEEEEEEcccccEEcccHHHHHHHHHHHHHccccEEEEEEcccEEcccccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHccccccEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccEEEEEcccccEEEEccccEEcccccccccccccEEEEEEEEEcccEEEEEEcccccccccccccccc //