[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37490.1
DDBJ      :             integral membrane protein MviN
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  428/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:518 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   44->382 PF03023 * MVIN 5e-29 31.7 %
:HMM:PFM   26->461 PF03023 * MVIN 7.9e-87 34.6 431/452  
:BLT:SWISS 1->382 MVIN_RHIME 5e-33 31.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37490.1 GT:GENE ABE37490.1 GT:PRODUCT integral membrane protein MviN GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(287292..288848) GB:FROM 287292 GB:TO 288848 GB:DIRECTION - GB:PRODUCT integral membrane protein MviN GB:PROTEIN_ID ABE37490.1 GB:DB_XREF GI:91681188 InterPro:IPR004268 LENGTH 518 SQ:AASEQ MIRPILTVSAGTLSSRLLGFVRDALVAALLGAGVVADAFLLAFQLVNVARRLLTEGALNAALVPAWLRVREHNGAVAAAAYAGRLLGTVALATLLLALLLGVFMPLLIALLAPGFVGHPTLLMATRDARLMLPYLAFAGPVAVMMGLFNAQGKVGLTAFSPLLFNVALIVVTAALLLWHANDTQAALILSATIGVAGLMQLGIVVFNGRGERLATPLRASFDPSMRAFFAKAIPGMIANSGPQLLIVIGAIVASSKPSAVSWLYFANRLIELPLGIVGVAMGAVLVPELARAVRGDDRAALSDAASRGLELAIGVALPAMLGLIVLREPIVRVLFEHGAFTASDTAATALALGLLALGLPAQVLAKTWSAAFFAREDTSTPLFATLVALGVALAAALLLGRTYGASGVAAAIALGAWSNAALLLGRGLARFGVAIDPAARRRVALIVLAAGAMGGLLWLKAGFVLPLVAEASTLAQAAVLGVLIAGGLIIYAALLILFGVVRPAAALGALRRPRGLRG GT:EXON 1|1-518:0| BL:SWS:NREP 1 BL:SWS:REP 1->382|MVIN_RHIME|5e-33|31.6|380/535| TM:NTM 13 TM:REGION 28->49| TM:REGION 99->121| TM:REGION 129->151| TM:REGION 156->178| TM:REGION 186->208| TM:REGION 233->255| TM:REGION 270->292| TM:REGION 310->332| TM:REGION 344->366| TM:REGION 379->401| TM:REGION 410->432| TM:REGION 445->467| TM:REGION 483->505| SEG 23->43|dalvaallgagvvadafllaf| SEG 75->82|avaaaaya| SEG 85->102|llgtvalatlllalllgv| SEG 166->177|valivvtaalll| SEG 294->309|rgddraalsdaasrgl| SEG 338->365|gaftasdtaatalalgllalglpaqvla| SEG 384->400|atlvalgvalaaalllg| SEG 404->416|gasgvaaaialga| SEG 420->430|aalllgrglar| SEG 438->462|aarrrvalivlaagamggllwlkag| SEG 474->517|laqaavlgvliaggliiyaallilfgvvrpaaalgalrrprglr| RP:PFM:NREP 1 RP:PFM:REP 44->382|PF03023|5e-29|31.7|334/450|MVIN| HM:PFM:NREP 1 HM:PFM:REP 26->461|PF03023|7.9e-87|34.6|431/452|MVIN| OP:NHOMO 446 OP:NHOMOORG 429 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------11-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------1---------1-----1211-1-1-22---1-----1-111111111112222212222211111111111-1111111111111111111111111-1111111111-111111111111111111111-------111111---11111111111----11---1111111111111111111111111111111111-11---1--1-111111111111111111111111111111-1111-11111111-11111--1------------1-111-1---1---1111111-1111111111111111111111111-11111---11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111-11111111221111-111111111-1111111111111111111111111111111111---------11111111111111111-----1111111-11-----11------------------------------------------1---11- -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 515-519| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHccHHHHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //