[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37514.1
DDBJ      :             Enoyl-CoA hydratase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  670/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->262 3gowA PDBj 1e-37 39.8 %
:RPS:PDB   4->261 1dubB PDBj 1e-45 25.4 %
:RPS:SCOP  1->261 1hzdA  c.14.1.3 * 3e-48 25.7 %
:HMM:SCOP  1->262 1wdkA4 c.14.1.3 * 1e-80 38.7 %
:RPS:PFM   15->185 PF00378 * ECH 4e-27 42.5 %
:HMM:PFM   15->186 PF00378 * ECH 7.6e-44 37.9 169/170  
:BLT:SWISS 1->262 PAAG_ECOLI 6e-32 35.4 %
:PROS 103->123|PS00166|ENOYL_COA_HYDRATASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37514.1 GT:GENE ABE37514.1 GT:PRODUCT Enoyl-CoA hydratase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(314122..314910) GB:FROM 314122 GB:TO 314910 GB:DIRECTION - GB:PRODUCT Enoyl-CoA hydratase GB:PROTEIN_ID ABE37514.1 GB:DB_XREF GI:91681212 InterPro:IPR001753 LENGTH 262 SQ:AASEQ MTDIVLQQLDQGLLTITMNRPDRRNALNQELIRGLVDAARRAADDPEVRAVLLKGAGGTFCVGGDVKSMAAAGAPPPLEAKVANLRRGMEVSRILHQMPKPVVAQIDGAAAGAGLSIALACDLRVVGASAKITTAFAKVGLSGDFGGTYFLTHLIGAAKARELYLTSPVLTAQEAHALGIVSCVVPDADVESAARELALSLAQGPSVTLGYIKTNINNAEHLSLEACFDAEALHHSRCAETADHKEAASAFVEKRAPSFQGR GT:EXON 1|1-262:0| BL:SWS:NREP 1 BL:SWS:REP 1->262|PAAG_ECOLI|6e-32|35.4|260/262| PROS 103->123|PS00166|ENOYL_COA_HYDRATASE|PDOC00150| SEG 108->120|gaaagaglsiala| SEG 191->202|esaarelalsla| BL:PDB:NREP 1 BL:PDB:REP 4->262|3gowA|1e-37|39.8|254/254| RP:PDB:NREP 1 RP:PDB:REP 4->261|1dubB|1e-45|25.4|252/259| RP:PFM:NREP 1 RP:PFM:REP 15->185|PF00378|4e-27|42.5|167/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 15->186|PF00378|7.6e-44|37.9|169/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 1->261|1hzdA|3e-48|25.7|257/266|c.14.1.3| HM:SCP:REP 1->262|1wdkA4|1e-80|38.7|261/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 4650 OP:NHOMOORG 872 OP:PATTERN 22-1--4965766776-121211A62331249------------------------------431-11 2233B325112443JVKBB-BQ55JZCCCCCIRTZTFQkm1L4O1-1411115554341197I18BGB7A7--------1418-----1111-1211--31222244322--------------11111121111145544---4711111111111111111111-112111111111111134323---6556666655757575554866447755B886421111119-111111111111111111111-1----1-----11---1-11111111111111111111111111111111111111111111111112--1131111111212-2221221-211-3-11-561426-15---1--2-4--B88L-----4-RFK423OFMID67656675665-32723J287BT-533-258869987B7F7889477767B11111111633-1BA4------------------------------BESC-7dTHOBFGDMC57776BBBA999848G8VMdcR14DDAA67BAHBHEJU239----33----------G7A3W991---------17872E13--3322A532---------------------------551441636535343345833335396466---1-1-------22122125334543466-365643354534344544534322331232222222222222253323333--322222222222---2222121111-5433111111111111111998793956441AAAA8A685A9B98464----------111311111232333322322222-------1444444-----------------------------------------------11 ----553-322-4367622556674626645465532633333434344465C6353244443-------1----1----1------1-46264642221216433-8C3C9B8BB74224692EA3A2SzG-Q7E2133936A643771733B3467A9B55A772754DA8863333N44245979E5762465533 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 100.0 SQ:SECSTR cccEEEEcGGGcEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEccccEEEccccHHHHTTccHHHHHHHHHHHHTTTTTTGGGGGGccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEcGGGGGTccccccTTTHHHHHHcHHHHHHHHHHccEEEHHHHHHHTcccEEEcTTTHHHHHHHHHHHHHTccHHHHHHHHHHHHGGGTccHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTTcccccccH DISOP:02AL 259-263| PSIPRED cccEEEEEEEccEEEEEEccHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccc //