[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37522.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:293 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   49->211 PF11306 * DUF3108 1e-07 31.8 %
:HMM:PFM   49->277 PF11306 * DUF3108 8.5e-46 28.9 204/207  
:BLT:SWISS 71->185 TRUB1_RAT 8e-05 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37522.1 GT:GENE ABE37522.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(324975..325856) GB:FROM 324975 GB:TO 325856 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37522.1 GB:DB_XREF GI:91681220 LENGTH 293 SQ:AASEQ MNIPVSRPSRRQAHASLMPGLIAGLLTIGLASIAPLDRAAAQGKLDARYEATLAGIEVGKGGWVIEITDDGYAAAANGATSGVLQAFSRGNGSGEAQGRLVNGQFSPMNYMATTTSAKKTETIRITLANGNVKESSIEPEQPHDADRIPVTEAHRRGVVDPMTGSILRVPGVGDLISPDSCRVSTPIFDGRMRYDLRMDYKRIETVKAEKGYQGPVLVCGIYFTPVSGYIPDRAAIKYLVEQRGMEVWLAPIAGTRMLVPFRLKIPTPLGNAVLQATQFVTKATPPKSVSRTQ GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 71->185|TRUB1_RAT|8e-05|32.7|98/341| SEG 20->34|gliaglltiglasia| RP:PFM:NREP 1 RP:PFM:REP 49->211|PF11306|1e-07|31.8|151/201|DUF3108| HM:PFM:NREP 1 HM:PFM:REP 49->277|PF11306|8.5e-46|28.9|204/207|DUF3108| OP:NHOMO 53 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-11211211111-11111111111111--2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,10-10,101-102,106-121,283-294| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccEEEEEEEEEccEEEccEEEEEEEEcccEEEEEEEEEEEEEEEEccccEEEEEEEEEEccEEEEEEEEEEccccccEEEEEEEEccccEEEEEEccccccccccccccHHHHccccHHHHHHHHHccccccccccHHcccEEEEEcccEEEEEEEEccccEEccccccccccEEEEEEEEEEccccccccHHHHHHHcccccEEEEEEEcccEEEEEEEEEEccEEEEEEEEEEEEEEcccccccHHccc //