[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37535.1
DDBJ      :             acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
Swiss-Prot:ACCA_RHOP2   RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha;         Short=Acetyl-CoA carboxylase carboxyltransferase subunit alpha;         Short=ACCase subunit alpha;         EC=6.4.1.2;

Homologs  Archaea  0/68 : Bacteria  731/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->320 2f9yA PDBj 2e-70 52.5 %
:RPS:PDB   64->197 3buzA PDBj 7e-22 13.8 %
:RPS:SCOP  11->321 2f9yA1  c.14.1.4 * 6e-41 43.3 %
:HMM:SCOP  11->322 2f9yA1 c.14.1.4 * 1e-91 39.1 %
:RPS:PFM   11->154 PF03255 * ACCA 7e-44 50.0 %
:HMM:PFM   12->154 PF03255 * ACCA 4e-59 50.3 143/145  
:HMM:PFM   103->252 PF01039 * Carboxyl_trans 2e-19 23.9 142/493  
:BLT:SWISS 5->324 ACCA_RHOP2 e-148 93.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37535.1 GT:GENE ABE37535.1 GT:PRODUCT acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 340595..341569 GB:FROM 340595 GB:TO 341569 GB:DIRECTION + GB:PRODUCT acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha GB:PROTEIN_ID ABE37535.1 GB:DB_XREF GI:91681233 InterPro:IPR001095 InterPro:IPR011763 LENGTH 324 SQ:AASEQ MSLVMSEPMRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEVSRIEEKAAQALNELYAALTPWQKTQVARHPQRPHCVDYIQGLITEFTPLAGDRKFGEDEALIGGFGRFRGESICVLGQEKGSSTETRLKHNFGMARPEGYRKAVRLMEMADRFGIPVLSLVDTAGAYPGIGAEERGQAEAIARSTDACLQLGVPNVAVVIGEGGSGGAIAIATANKVLMLEHAIYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLRFGVIDQILAEPKGGAHRDPEAMIATTGDAIAAAFAELNGLDSSTVRNKRRQKFLEIGRKLG GT:EXON 1|1-324:0| SW:ID ACCA_RHOP2 SW:DE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Short=Acetyl-CoA carboxylase carboxyltransferase subunit alpha; Short=ACCase subunit alpha; EC=6.4.1.2; SW:GN Name=accA; OrderedLocusNames=RPB_0532; SW:KW ATP-binding; Complete proteome; Cytoplasm; Fatty acid biosynthesis;Ligase; Lipid synthesis; Nucleotide-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 5->324|ACCA_RHOP2|e-148|93.4|320/320| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 199->217|vavvigeggsggaiaiata| SEG 284->298|amiattgdaiaaafa| BL:PDB:NREP 1 BL:PDB:REP 11->320|2f9yA|2e-70|52.5|299/301| RP:PDB:NREP 1 RP:PDB:REP 64->197|3buzA|7e-22|13.8|123/413| RP:PFM:NREP 1 RP:PFM:REP 11->154|PF03255|7e-44|50.0|144/145|ACCA| HM:PFM:NREP 2 HM:PFM:REP 12->154|PF03255|4e-59|50.3|143/145|ACCA| HM:PFM:REP 103->252|PF01039|2e-19|23.9|142/493|Carboxyl_trans| RP:SCP:NREP 1 RP:SCP:REP 11->321|2f9yA1|6e-41|43.3|300/301|c.14.1.4| HM:SCP:REP 11->322|2f9yA1|1e-91|39.1|312/0|c.14.1.4|1/1|ClpP/crotonase| OP:NHOMO 779 OP:NHOMOORG 743 OP:PATTERN -------------------------------------------------------------------- 111-1-11111-1---111-1---11111111-1111222-111---1------1-----111--2211----------111211111--------1--111111111111111111111111112222221221211122---1211111111111111111111111111111111111111111111-111111111211111111111121112111211111111121111111111111111111111-111111-1-22111111111111111111111111111111111111111111111111111111111--11111111111111111111111----2111111111111------11111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----------------------------11111111111111111111111111111112111111111111111111111111111111111121111111111----11111121111111111111111111--1111111111111111111111111111111111111--------------------1-11111------11111111111111111-111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111---------------1-1-----------------------------------11- -----------1--------------------------------------------------------------------------------------------------------------------------------------------------1----------------111-----113--3-21------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 95.4 SQ:SECSTR #######cccccccTTHHTTcHHHHHHHHHHHH####HHHHHHTcTTcHHHHHHHHHTTcccHHHHHHHTTccccccEEEEEEEccGGGTcccccGGGcTTTTcHHHHHHHHHHHTTcEEEEccccTTHHHcEEEEccccccGGGTTccEEEEHHEEEcTTccEEEGGGccccccccEEcEEEEEEEEEEEEETTEEEEEEEccEEEcGGGHHHHHccEEEEETTTcEEEcccHHccHHHHHHHHcccccHHHHHcHHHHHHTcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHTTTTTTccHHHHHHHHHHHHHHcc#### DISOP:02AL 1-7,324-325| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccHHHHHHHHccccEEcccccccccccEEEEEEEEEccEEEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHccHHHHHHHHHHHHHcccccEEEEEEcccccccEEEHHHHHHHHHHHccEEEEEcHHHHHHHHHccHHHHHHHHHHccccHHHHHHcccccEEcccccccccccHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHc //