[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37549.1
DDBJ      :             LSU ribosomal protein L32P
Swiss-Prot:RL32_RHOPS   RecName: Full=50S ribosomal protein L32;

Homologs  Archaea  0/68 : Bacteria  110/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:60 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->57 1vs60 PDBj 1e-07 50.9 %
:RPS:PDB   2->49 3d5b5 PDBj 3e-09 35.4 %
:RPS:SCOP  3->56 2hgj41  g.41.8.5 * 1e-14 38.9 %
:HMM:SCOP  2->57 2i2t01 g.41.8.5 * 6.5e-19 52.7 %
:RPS:PFM   2->56 PF01783 * Ribosomal_L32p 1e-06 47.3 %
:HMM:PFM   2->57 PF01783 * Ribosomal_L32p 1.1e-22 46.4 56/56  
:BLT:SWISS 1->60 RL32_RHOPS 2e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37549.1 GT:GENE ABE37549.1 GT:PRODUCT LSU ribosomal protein L32P GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(359642..359824) GB:FROM 359642 GB:TO 359824 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L32P GB:PROTEIN_ID ABE37549.1 GB:DB_XREF GI:91681247 InterPro:IPR002677 LENGTH 60 SQ:AASEQ MAVPRRKTSPSRRGMRRSADALKRPTYAEDKDSGELRRPHHLDLKTGMYKGRQVIKKKDA GT:EXON 1|1-60:0| SW:ID RL32_RHOPS SW:DE RecName: Full=50S ribosomal protein L32; SW:GN Name=rpmF; OrderedLocusNames=RPD_0311; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|RL32_RHOPS|2e-31|100.0|60/60| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 2->57|1vs60|1e-07|50.9|55/56| RP:PDB:NREP 1 RP:PDB:REP 2->49|3d5b5|3e-09|35.4|48/52| RP:PFM:NREP 1 RP:PFM:REP 2->56|PF01783|1e-06|47.3|55/56|Ribosomal_L32p| HM:PFM:NREP 1 HM:PFM:REP 2->57|PF01783|1.1e-22|46.4|56/56|Ribosomal_L32p| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01783|IPR002677| GO:PFM GO:0006412|"GO:translation"|PF01783|IPR002677| GO:PFM GO:0015934|"GO:large ribosomal subunit"|PF01783|IPR002677| RP:SCP:NREP 1 RP:SCP:REP 3->56|2hgj41|1e-14|38.9|54/57|g.41.8.5| HM:SCP:REP 2->57|2i2t01|6.5e-19|52.7|55/0|g.41.8.5|1/1|Zn-binding ribosomal proteins| OP:NHOMO 112 OP:NHOMOORG 110 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111111113111111111111111111111111-111111111111111111-1111111111----------111111111-111111--------11--11--11-111111----11111----------------------------------------------------------11111111--------------------------------------------------------------------------------------------------1-11--------------------------------------------------------------------------------------------1----------1--1-----------------------------------------------------1----------------------------1---------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 93.3 SQ:SECSTR #ccccccccHHHHHHHTTTTcccccccEEccccccEEccccccTTTccccccccccc### DISOP:02AL 1-20,57-61| PSIPRED cccccccccHHHcccHHHHHHcccccEEEcccccccEEEEEEEccccccccEEEEEcccc //