[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37562.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   64->115 1z9cC PDBj 2e-05 32.7 %
:RPS:PDB   27->161 2a61A PDBj 6e-13 23.5 %
:RPS:SCOP  37->160 2ethA1  a.4.5.28 * 1e-14 19.4 %
:HMM:SCOP  23->160 2fbkA1 a.4.5.28 * 2e-21 29.0 %
:RPS:PFM   48->107 PF01047 * MarR 1e-04 36.8 %
:HMM:PFM   50->109 PF01047 * MarR 1.9e-13 36.8 57/59  
:BLT:SWISS 16->121 PECS_DICD3 2e-06 27.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37562.1 GT:GENE ABE37562.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 377484..377993 GB:FROM 377484 GB:TO 377993 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID ABE37562.1 GB:DB_XREF GI:91681260 InterPro:IPR000835 LENGTH 169 SQ:AASEQ MPRKAKLGLAVQSIAVDPSTVGEFVTAIGSIAVYLDEIRQFRAKSLGISGPQFAMLTTIRGLDEGDGISVRHVAKAIHVDSSFITTQSKILEKKGLLRRQTDETDARVVNLSLTDKAYKQIAGLAADEQSLNEFIFADLSRDAFEGVTAQLTGLKARLEKACLKIAGGF GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 16->121|PECS_DICD3|2e-06|27.2|103/166| BL:PDB:NREP 1 BL:PDB:REP 64->115|1z9cC|2e-05|32.7|52/138| RP:PDB:NREP 1 RP:PDB:REP 27->161|2a61A|6e-13|23.5|132/142| RP:PFM:NREP 1 RP:PFM:REP 48->107|PF01047|1e-04|36.8|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 50->109|PF01047|1.9e-13|36.8|57/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 37->160|2ethA1|1e-14|19.4|124/140|a.4.5.28| HM:SCP:REP 23->160|2fbkA1|2e-21|29.0|138/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 17 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-2---21421--------------------------------------------------------------------------------------------------------------11----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 83.4 SQ:SECSTR ####################HHcHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHccHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHH######## DISOP:02AL 1-8| PSIPRED cccccHHHccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccc //