[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37607.1
DDBJ      :             Hpr(Ser) kinase/phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.91.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->86 2qmhL PDBj 7e-07 49.2 %
:HMM:SCOP  4->103 1ko7A2 c.91.1.2 * 1.3e-17 38.7 %
:RPS:PFM   21->86 PF07475 * Hpr_kinase_C 2e-08 59.3 %
:HMM:PFM   4->86 PF07475 * Hpr_kinase_C 6.9e-15 44.7 76/171  
:BLT:SWISS 21->86 HPRK_STRTD 6e-08 49.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37607.1 GT:GENE ABE37607.1 GT:PRODUCT Hpr(Ser) kinase/phosphatase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 435283..435744 GB:FROM 435283 GB:TO 435744 GB:DIRECTION + GB:PRODUCT Hpr(Ser) kinase/phosphatase GB:PROTEIN_ID ABE37607.1 GB:DB_XREF GI:91681305 LENGTH 153 SQ:AASEQ MSAAGSSSVHASAVRVGDHAVLIRGPSGSGKSRLAFGLIVAGRTGQIPDAELIGDDRVFLERRDGRLWVRPAPELAGMIEVRGLGIRRCPNAPEAVIGLIVDLAADDAARLPEAAAMQIRIEGVELPRVPVAAEFDPLPLVVAALTTIDAVGA GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 21->86|HPRK_STRTD|6e-08|49.2|59/309| SEG 2->16|saagsssvhasavrv| SEG 99->116|livdlaaddaarlpeaaa| BL:PDB:NREP 1 BL:PDB:REP 21->86|2qmhL|7e-07|49.2|59/161| RP:PFM:NREP 1 RP:PFM:REP 21->86|PF07475|2e-08|59.3|59/157|Hpr_kinase_C| HM:PFM:NREP 1 HM:PFM:REP 4->86|PF07475|6.9e-15|44.7|76/171|Hpr_kinase_C| GO:PFM:NREP 5 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF07475|IPR011104| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF07475|IPR011104| GO:PFM GO:0004672|"GO:protein kinase activity"|PF07475|IPR011104| GO:PFM GO:0005524|"GO:ATP binding"|PF07475|IPR011104| GO:PFM GO:0006109|"GO:regulation of carbohydrate metabolic process"|PF07475|IPR011104| HM:SCP:REP 4->103|1ko7A2|1.3e-17|38.7|93/0|c.91.1.2|1/1|PEP carboxykinase-like| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111-----------------1---------1--------11------111--------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 59 STR:RPRED 38.6 SQ:SECSTR ####################EEEEccccccHHHHHHHHHHTTc#######EEEEccEEEEEEcccccEEEEccccTTEEEETTTEE################################################################### DISOP:02AL 1-10,153-154| PSIPRED cccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHHHHccccccEEEEccEEEEEEEccEEEEEccHHHccEEEEEEccEEEcccccccEEEEEEEEccccccccccccEEEEEEcccccccEEccccccHHHHHHHHHHHHHHccc //