[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37612.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 11->114 WDR75_DANRE 2e-04 25.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37612.1 GT:GENE ABE37612.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 440240..440926 GB:FROM 440240 GB:TO 440926 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE37612.1 GB:DB_XREF GI:91681310 LENGTH 228 SQ:AASEQ MDPVLTEIPGRILDLAFGALSQANMHAVFSDAGNEHWDFISVTNTAHAGELFLKAIIAKEHPLLIFKDLFSLDDNRTDSIELVNLIKRGKTHEFERLPQIIWAVTGKRIPNPECYERLRRARNSIQHFCAPEDEDFRDLSLEFIYTIIDPLIFEHFESFAIEYHEDHSAGDDYVVATLLRKQLRFSVPDDFDITEIRIRDEISASSQTYREWITGELNRIGRLDLLNK GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 11->114|WDR75_DANRE|2e-04|25.2|103/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,228-229| PSIPRED cccHHHHccHHHHHHHHHHHccccHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccEEEEEEHHccccHHHHHHHHHHHHHHccccccccc //