[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37620.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->149 PF10003 * DUF2244 2e-24 44.2 %
:HMM:PFM   21->160 PF10003 * DUF2244 1.5e-51 45.0 140/140  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37620.1 GT:GENE ABE37620.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 449106..449621 GB:FROM 449106 GB:TO 449621 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE37620.1 GB:DB_XREF GI:91681318 LENGTH 171 SQ:AASEQ MALDTDLDPELAQPKLFSALLKPHRALSHKAFLVLMGVLGTISFAVGVGFWTMGAWPVFGFFGLDLLAIYIAFRISFARGRASEEISITISELRVRRISHRGHVAEWVLNPLWVRLEKIVHAEFGIEQLYLVSRGRRVSVASFLGAEEKASFANALTAALDAARRGPLVRH GT:EXON 1|1-171:0| TM:NTM 2 TM:REGION 26->48| TM:REGION 57->79| SEG 150->163|asfanaltaaldaa| RP:PFM:NREP 1 RP:PFM:REP 21->149|PF10003|2e-24|44.2|129/140|DUF2244| HM:PFM:NREP 1 HM:PFM:REP 21->160|PF10003|1.5e-51|45.0|140/140|DUF2244| OP:NHOMO 52 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1111111111111111111111-1-11111111111-11111111111111-1-------------------1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-4,169-172| PSIPRED cccccccccccccccEEEEEEEccHHccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHEEEcHHHEEEEEEcccccEEEEEEcccEEEEEEEEEccccEEEEEEEEEcEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccc //