[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37633.1
DDBJ      :             RNAse PH
Swiss-Prot:RNPH_RHOPS   RecName: Full=Ribonuclease PH;         Short=RNase PH;         EC=2.7.7.56;AltName: Full=tRNA nucleotidyltransferase;

Homologs  Archaea  32/68 : Bacteria  598/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
d.101.1d.14.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->237 1r6mA PDBj 9e-70 57.9 %
:RPS:PDB   1->237 3dd6A PDBj 7e-60 48.3 %
:RPS:SCOP  1->151 1oypA1  d.14.1.4 * 7e-36 56.0 %
:RPS:SCOP  155->237 1udnA2  d.101.1.1 * 3e-20 44.6 %
:HMM:SCOP  1->140 1oysA1 d.14.1.4 * 6.5e-44 45.0 %
:HMM:SCOP  151->238 1r6lA2 d.101.1.1 * 3.1e-22 39.8 %
:RPS:PFM   10->139 PF01138 * RNase_PH 2e-15 34.9 %
:RPS:PFM   159->223 PF03725 * RNase_PH_C 9e-04 32.3 %
:HMM:PFM   10->140 PF01138 * RNase_PH 7.6e-29 34.6 127/132  
:HMM:PFM   159->224 PF03725 * RNase_PH_C 4.7e-14 22.7 66/68  
:BLT:SWISS 1->237 RNPH_RHOPS e-126 100.0 %
:PROS 116->128|PS01277|RIBONUCLEASE_PH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37633.1 GT:GENE ABE37633.1 GT:PRODUCT RNAse PH GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 462181..462894 GB:FROM 462181 GB:TO 462894 GB:DIRECTION + GB:PRODUCT RNAse PH GB:PROTEIN_ID ABE37633.1 GB:DB_XREF GI:91681331 InterPro:IPR001247 InterPro:IPR002381 LENGTH 237 SQ:AASEQ MRPSRRAPDELRAVSLERGVVKYAEGSCLVKFGDTHVLVTATLEERLPPWLKGQGRGWVTAEYGMLPRATLERTRREAAAGKQNGRTVEIQRLIGRSLRAIVDLQALGERQITVDCDVLQADGGTRTASITGAWVALADCLGWMKTRNMIKGTVLRDNVAAISCGIYNGTPVLDLDYAEDSEAETDANFVMTGDGRIIEVQGTAEKTPFSQDEFLALMALAQKGVTRLVDLQKMAVA GT:EXON 1|1-237:0| SW:ID RNPH_RHOPS SW:DE RecName: Full=Ribonuclease PH; Short=RNase PH; EC=2.7.7.56;AltName: Full=tRNA nucleotidyltransferase; SW:GN Name=rph; OrderedLocusNames=RPD_0395; SW:KW Complete proteome; Nucleotidyltransferase; Transferase;tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->237|RNPH_RHOPS|e-126|100.0|237/237| GO:SWS:NREP 3 GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| PROS 116->128|PS01277|RIBONUCLEASE_PH|PDOC00983| SEG 68->80|ratlertrreaaa| BL:PDB:NREP 1 BL:PDB:REP 2->237|1r6mA|9e-70|57.9|233/236| RP:PDB:NREP 1 RP:PDB:REP 1->237|3dd6A|7e-60|48.3|236/244| RP:PFM:NREP 2 RP:PFM:REP 10->139|PF01138|2e-15|34.9|126/130|RNase_PH| RP:PFM:REP 159->223|PF03725|9e-04|32.3|65/68|RNase_PH_C| HM:PFM:NREP 2 HM:PFM:REP 10->140|PF01138|7.6e-29|34.6|127/132|RNase_PH| HM:PFM:REP 159->224|PF03725|4.7e-14|22.7|66/68|RNase_PH_C| GO:PFM:NREP 6 GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF01138|IPR001247| GO:PFM GO:0003723|"GO:RNA binding"|PF01138|IPR001247| GO:PFM GO:0006396|"GO:RNA processing"|PF01138|IPR001247| GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF03725|IPR015847| GO:PFM GO:0003723|"GO:RNA binding"|PF03725|IPR015847| GO:PFM GO:0006396|"GO:RNA processing"|PF03725|IPR015847| RP:SCP:NREP 2 RP:SCP:REP 1->151|1oypA1|7e-36|56.0|134/134|d.14.1.4| RP:SCP:REP 155->237|1udnA2|3e-20|44.6|83/105|d.101.1.1| HM:SCP:REP 1->140|1oysA1|6.5e-44|45.0|140/151|d.14.1.4|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 151->238|1r6lA2|3.1e-22|39.8|88/88|d.101.1.1|1/1|Ribonuclease PH domain 2-like| OP:NHOMO 647 OP:NHOMOORG 645 OP:PATTERN -------11111111111-----1--------111-------------11-1111111111111-1-1 1111111111111111111-1111111111111111111111111111-1111111111111111111111-1111111--1-11111------------------------------------------------11111111-11111---111111111-1-1-1111-1-----1----111--11--11111111111111111111111111111111111111111--------------------1---------------------------------------------------------------------111---------1-11111-111--1--1--1111111111111111-111111111-----111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------111111111111111-----11111111111111111111111111111111111111-111111111--111-11111111111111111111111---1----------1111111111111111--------------------------11111111111111111111111111111111--11111------11111111111-11111-11-1111111111111111111111111111111111111111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111--1------------------------------------------------------11 -----1--------------------------------------------------------------------------------1----------------1---1-12-----------------------------------------------------1-----11-1-----------1--1-11--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 100.0 SQ:SECSTR cccccccTTccccEEEEEcccccccEEEEEEETTEEEEEEEEEEccccGGGTTccccEEEEEEEEcTTcccccccccccHccccHHHHHHHHHHHHHHHHHccHHHHcccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHTTccccccccccEEEEEEEEETTTEEEcccHHHHHTEEEEEEEEEETTccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHG DISOP:02AL 44-55,72-88| PSIPRED cccccccHHHEEEEEEEEcccccccEEEEEEEcccEEEEEEEcccccccccccccEEEEEEEEEcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHcccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEccEEEEEccHHHHHHccccEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //