[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE37634.1
DDBJ      :             Ham1-like protein
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  809/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:210 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->205 1k7kA PDBj 2e-20 35.9 %
:RPS:PDB   8->200 1b78A PDBj 9e-30 25.6 %
:RPS:SCOP  8->205 1k7kA  c.51.4.1 * 3e-51 33.5 %
:HMM:SCOP  1->210 1k7kA_ c.51.4.1 * 3.5e-57 46.5 %
:RPS:PFM   9->205 PF01725 * Ham1p_like 1e-31 45.4 %
:HMM:PFM   9->206 PF01725 * Ham1p_like 2.7e-60 49.5 186/189  
:BLT:SWISS 1->208 NTPA_RHOPA 3e-90 89.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE37634.1 GT:GENE ABE37634.1 GT:PRODUCT Ham1-like protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 462947..463579 GB:FROM 462947 GB:TO 463579 GB:DIRECTION + GB:PRODUCT Ham1-like protein GB:PROTEIN_ID ABE37634.1 GB:DB_XREF GI:91681332 InterPro:IPR002637 LENGTH 210 SQ:AASEQ MHRRISGKLVIATHNPGKLAEMRELLAPYGIEAVSAGELGLGEPDETGDSFRANARIKAEAAAQAAKLPAFADDSGLSVDALDGAPGIFSARWAGEGKDFNAAMAQIERLLRERGATAPAQRGAHFVSALCVAWPDGHIEEVEARADGTLVWPPRGDAGFGYDPMFLPDGHDRTFGEMSSIEKHGLPPLGLGLSHRARAFVKLAEICLGR GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 1->208|NTPA_RHOPA|3e-90|89.9|208/210| SEG 53->72|anarikaeaaaqaaklpafa| SEG 185->193|glpplglgl| BL:PDB:NREP 1 BL:PDB:REP 8->205|1k7kA|2e-20|35.9|184/205| RP:PDB:NREP 1 RP:PDB:REP 8->200|1b78A|9e-30|25.6|172/184| RP:PFM:NREP 1 RP:PFM:REP 9->205|PF01725|1e-31|45.4|185/188|Ham1p_like| HM:PFM:NREP 1 HM:PFM:REP 9->206|PF01725|2.7e-60|49.5|186/189|Ham1p_like| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01725|IPR002637| RP:SCP:NREP 1 RP:SCP:REP 8->205|1k7kA|3e-51|33.5|188/207|c.51.4.1| HM:SCP:REP 1->210|1k7kA_|3.5e-57|46.5|200/209|c.51.4.1|1/1|ITPase-like| OP:NHOMO 861 OP:NHOMOORG 852 OP:PATTERN 111111-111111111---11111-----1----1----------1---111111111111-11---- 1111111111111111111-1111111111111111111111111111111111-1111111111111111-11111111-1-1-11111111111---11111111111111111111111111111-1111-1111111111111111111-111222222111111111111111211211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11-1111-1111111111---------1111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111------11111111111111111111111111111111111111111111111111111111111111111111111--------1-1------------------1------1111111111111 ----------1------------------------------------------------------------------------------------------------------1-------------1------------------------------------------1-----------------------1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 95.2 SQ:SECSTR HHHHHTTcEEEEcccHHHHHHHHHHTTTcTTccEEEEcccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEGGGTTcEETTHHHHHHHHTHHHHHHHHHTTcHHHTcTTTccccEEEEEEEEEEEETTEEEEEEEEEEEEEEccccccccccGGGGcEEETTccccGGGccHHHHT######cTTcHHHHHHHHHHHH#### DISOP:02AL 1-4| PSIPRED cccccccEEEEEEccccHHHHHHHHHHHcccEEEEHHHcccccccccccccccccccHHHHHHHHHcccccccccEEEEccccccccccEEHHccccccccHHHHHHHHHHHHHccccHHccEEEEEEEEEEEcccccEEEEEEEEEEEEEEcccccccccccEEEEEccccccHHHccHHHHcccccccccccHHHHHHHHHHHHHccc //